From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001224000
  • symbol?: brnQ2
  • description?: branched-chain amino acid transport system II carrier protein

      descriptions from strain specific annotations:

    • branched-chain amino acid transport system II carrier protein
    • branched-chain amino acid transporter II carrier protein
    • Branched-chain amino acid transport system carrier protein
    • branched chain amino acid ABC transporter
    • branched chain amino acid ABC transporter carrier protein
    • branched-chain amino acid transport protein
    • LIVCS family branched chain amino acid:cation symporter
    • putative amino acid transport system
  • strand?: -
  • coordinates?: 1511749..1512954
  • synteny block?: BlockID0007350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0302 (brnQ2)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0305
    08BA02176:
    C248_0294
    11819-97:
    MS7_0296
    71193:
    ST398NM01_0319
    ECT-R 2:
    ECTR2_266 (brnQ)
    ED133:
    SAOV_0258
    ED98:
    SAAV_0273 (brnQ2)
    HO 5096 0412:
    SAEMRSA15_02620
    JH1:
    SaurJH1_0296
    JH9:
    SaurJH9_0289
    JKD6008:
    SAA6008_00282 (brnQ)
    JKD6159:
    SAA6159_00281 (brnQ)
    LGA251:
    SARLGA251_02680
    M013:
    M013TW_0287
    MRSA252:
    SAR0303
    MSHR1132:
    SAMSHR1132_02800
    MSSA476:
    SAS0283
    Mu3:
    SAHV_0303
    Mu50:
    SAV0306
    MW2:
    MW0283
    RF122:
    SAB0243c
    ST398:
    SAPIG0319 (brnQ)
    T0131:
    SAT0131_00308 (spa)
    TCH60:
    HMPREF0772_10190 (brnQ)
    TW20:
    SATW20_03110
    USA300_TCH1516:
    USA300HOU_0325 (brnQ1)
    VC40:
    SAVC_01280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKQVIISGLMLFSLFFGAGNLIFPPMLGHTAGQNMWIGMLGFALTGILLPFITVIVVAF
    N315            MKKQVIISGLMLFSLFFGAGNLIFPPILGHTAGQNMWIGMLGFALTGILLPFITVIVVAF
    NCTC8325        ----------MLFSLFFGAGNLIFPPMLGHTAGQNMWIGMLGFALTGILLPFITVIVVAF
    Newman          MKKQVIISGLMLFSLFFGAGNLIFPPMLGHTAGQNMWIGMLGFALTGILLPFITVIVVAF
    USA300_FPR3757  ----------MLFSLFFGAGNLIFPPMLGHTAGQNMWIGMLGFALTGILLPFITVIVVAF
                              ****************:*********************************

    COL             YDEGVESVGNRIHPWFGFIFAVVIYMSIGAFYGIPRAANVAYEIGTRHILPVHNQWTLII
    N315            YDEGVESVGNRIHPWFGFIFAVVIYMSIGAFYGIPRAANVAYEIGTRHILPVHNQWTLII
    NCTC8325        YDEGVESVGNRIHPWFGFIFAVVIYMSIGAFYGIPRAANVAYEIGTRHILPVHNQWTLII
    Newman          YDEGVESVGNRIHPWFGFIFAVVIYMSIGAFYGIPRAANVAYEIGTRHILPVHNQWTLII
    USA300_FPR3757  YDEGVESVGNRIHPWFGFIFAVVIYMSIGAFYGIPRAANVAYEIGTRHILPVHNQWTLII
                    ************************************************************

    COL             FAAIFFAIVYWISLNPSKIVDNLGKLLTPLLLLMVALLSIAVIFNPESALSAPKDKYITH
    N315            FAAIFFAIVYWISLNPSKIVDNLGKLLTPLLLLMVALLSIAVIFNPESALSAPKDKYITH
    NCTC8325        FAAIFFAIVYWISLNPSKIVDNLGKLLTPLLLLMVALLSIAVIFNPESALSAPKDKYITH
    Newman          FAAIFFAIVYWISLNPSKIVDNLGKLLTPLLLLMVALLSIAVIFNPESALSAPKDKYITH
    USA300_FPR3757  FAAIFFAIVYWISLNPSKIVDNLGKLLTPLLLLMVALLSIAVIFNPESALSAPKDKYITH
                    ************************************************************

    COL             PFISGSLEGYFTMDLVAALAFSVVIVNGYKFKGLTDRMKILKYVCFSGLIAAILLGMIYF
    N315            PFISGSLEGYFTMDLVAALAFSVVIVNGYKFKGLTDRMKILKYVCFSGLIAAILLGMIYF
    NCTC8325        PFISGSLEGYFTMDLVAALAFSVVIVNGYKFKGLTDRMKILKYVCFSGLIAAILLGMIYF
    Newman          PFISGSLEGYFTMDLVAALAFSVVIVNGYKFKGLTDRMKILKYVCFSGLIAAILLGMIYF
    USA300_FPR3757  PFISGSLEGYFTMDLVAALAFSVVIVNGYKFKGLTDRMKILKYVCFSGLIAAILLGMIYF
                    ************************************************************

    COL             ALAYVGASTAPGNFKDGTDILTYNSLRLFGSFGNLVFGMTVILACLTTCIGLVNACATFT
    N315            ALAYVGASTAPGNFKDGTDILTYNSLRVFGSFGNIVFGMTVILACLTTCIGLVNACATFT
    NCTC8325        ALAYVGASTAPGNFKDGTDILTYNSLRLFGSFGNLVFGMTVILACLTTCIGLVNACATFT
    Newman          ALAYVGASTAPGNFKDGTDILTYNSLRLFGSFGNLVFGMTVILACLTTCIGLVNACATFT
    USA300_FPR3757  ALAYVGASTAPGNFKDGTDILTYNSLRLFGSFGNLVFGMTVILACLTTCIGLVNACATFT
                    ***************************:******:*************************

    COL             KKHVPKFSYKIFALIFSIIGFLFTTLGLEMILKIAVPLLTLIYPVSIALVLISFANMFST
    N315            KKHVPKFSYKIFALIFSIIGFLFTTLGLEMILKIAVPLLTLIYPVSIALVLISFANMFST
    NCTC8325        KKHVPKFSYKIFALIFSIIGFLFTTLGLEMILKIAVPLLTLIYPVSIALVLISFANMFST
    Newman          KKHVPKFSYKIFALIFSIIGFLFTTLGLEMILKIAVPLLTLIYPVSIALVLISFANMFST
    USA300_FPR3757  KKHVPKFSYKIFALIFSIIGFLFTTLGLEMILKIAVPLLTLIYPVSIALVLISFANMFST
                    ************************************************************

    COL             FRFSWAYRLATVITLIISILQILNSFNLLHGVILKSFMMLPLADIDLAWLVPFMLFAIIG
    N315            FRFSWAYRLATVITLIISILQILNSFNLLHGVILKWFMMLPLADIDLAWLVPFMLFAIIG
    NCTC8325        FRFSWAYRLATVITLIISILQILNSFNLLHGVILKSFMMLPLADIDLAWLVPFMLFAIIG
    Newman          FRFSWAYRLATVITLIISILQILNSFNLLHGVILKSFMMLPLADIDLAWLVPFMLFAIIG
    USA300_FPR3757  FRFSWAYRLATVITLIISILQILNSFNLLHGVILKSFMMLPLADIDLAWLVPFMLFAIIG
                    *********************************** ************************

    COL             FIIDVFIRRPKQATT
    N315            FIIDVVIRRPKQATT
    NCTC8325        FIIDVFIRRPKQATT
    Newman          FIIDVFIRRPKQATT
    USA300_FPR3757  FIIDVFIRRPKQATT
                    *****.*********