From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001238000
  • symbol?: nanT
  • description?: sodium:solute symporter family protein

      descriptions from strain specific annotations:

    • sodium:solute symporter family protein
    • putative sialic acid transporter
    • putative sodium/glucose cotransporter
    • sialic acid transporter
    • sodium/glucose cotransporter
    • sodium symporter family protein
    • SSS family solute/sodium (Na+) symporter
    • transporter, solute:sodium symporter (SSS) family protein
    • transport protein
  • strand?: -
  • coordinates?: 1522546..1524078
  • synteny block?: BlockID0007490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0313
    08BA02176:
    C248_0303
    11819-97:
    MS7_0304
    71193:
    ST398NM01_0327
    ECT-R 2:
    ECTR2_274
    ED133:
    SAOV_0267
    ED98:
    SAAV_0281
    HO 5096 0412:
    SAEMRSA15_02700
    JH1:
    SaurJH1_0304
    JH9:
    SaurJH9_0297
    JKD6008:
    SAA6008_00290
    JKD6159:
    SAA6159_00290
    LGA251:
    SARLGA251_02760
    M013:
    M013TW_0295
    MRSA252:
    SAR0311
    MSHR1132:
    SAMSHR1132_02880
    MSSA476:
    SAS0291
    Mu3:
    SAHV_0311
    Mu50:
    SAV0314
    MW2:
    MW0291
    RF122:
    SAB0251c
    ST398:
    SAPIG0327
    T0131:
    SAT0131_00318
    TCH60:
    HMPREF0772_10181
    TW20:
    SATW20_03190
    USA300_TCH1516:
    USA300HOU_0334
    VC40:
    SAVC_01320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKEVGFGTLNWVAVIIYLLAMLFIGVYFTKRASQSTNSFFTASGRLPSWVVGFSIYATTL
    N315            MKEVGFGTLNWVAVIIYLLAMLFIGVYFTKRASQSTNSFFTASGRLPSWVVGFSIYATTL
    NCTC8325        MKEVGFGTLNWVAVIIYLLAMLFIGVYFTKRASQSTNSFFTASGRLPSWVVGFSIYATTL
    Newman          MKEVGFGTLNWVAVIIYLLAMLFIGVYFTKRASQSTNSFFTASGRLPSWVVGFSIYATTL
    USA300_FPR3757  MKEVGFGTLNWVAVIIYLLAMLFIGVYFTKRASQSTNSFFTASGRLPSWVVGFSIYATTL
                    ************************************************************

    COL             SAITFMSTPEKAFLTDWSYIAGNIAIVAIIPLLIYFYVPFFKKLKVTSAYEYLEARFGPS
    N315            SAITFMSTPEKAFLTDWSYIAGNIAIVAIIPLLIYFYVPFFKKLKVTSAYEYLEARFGPS
    NCTC8325        SAITFMSTPEKAFLTDWSYIAGNIAIVAIIPLLIYFYVPFFKKLKVTSAYEYLEARFGPS
    Newman          SAITFMSTPEKAFLTDWSYIAGNIAIVAIIPLLIYFYVPFFKKLKVTSAYEYLEARFGPS
    USA300_FPR3757  SAITFMSTPEKAFLTDWSYIAGNIAIVAIIPLLIYFYVPFFKKLKVTSAYEYLEARFGPS
                    ************************************************************

    COL             IRVIGSLLFVVYHLGRVAIVIYLPTLAITSVSDMNPYIVASLVGLLCILYTFLGGFEGVV
    N315            IRVIGSLLFVVYHLGRVAIVIYLPTLAITSVSDMNPYIVASLVGLLCILYTFLGGFEGVV
    NCTC8325        IRVIGSLLFVVYHLGRVAIVIYLPTLAITSVSDMNPYIVASLVGLLCILYTFLGGFEGVV
    Newman          IRVIGSLLFVVYHLGRVAIVIYLPTLAITSVSDMNPYIVASLVGLLCILYTFLGGFEGVV
    USA300_FPR3757  IRVIGSLLFVVYHLGRVAIVIYLPTLAITSVSDMNPYIVASLVGLLCILYTFLGGFEGVV
                    ************************************************************

    COL             WSDFIQGVILLGGALVIIILGVVNIKGGFGTVFADAIEHKKLISADNWKLNTAAAAIPII
    N315            WSDFIQGVILLGGALVIIILGVMNIKGGFGTVFADAIEHKKLISADNWKLNTAAAAIPII
    NCTC8325        WSDFIQGVILLGGALVIIILGVVNIKGGFGTVFADAIEHKKLISADNWKLNTAAAAIPII
    Newman          WSDFIQGVILLGGALVIIILGVVNIKGGFGTVFADAIEHKKLISADNWKLNTAAAAIPII
    USA300_FPR3757  WSDFIQGVILLGGALVIIILGVVNIKGGFGTVFADAIEHKKLISADNWKLNTAAAAIPII
                    **********************:*************************************

    COL             FLGNIFNNLYQYTASQDVVQRYQASDSLKETNKSLWTNGILALISAPLFYGMGTMLYSFY
    N315            FLGNIFNNLYQYTASQDVVQRYQASDSLKETNKSLWTNGILALISAPLFYGMGTMLYSFY
    NCTC8325        FLGNIFNNLYQYTASQDVVQRYQASDSLKETNKSLWTNGILALISAPLFYGMGTMLYSFY
    Newman          FLGNIFNNLYQYTASQDVVQRYQASDSLKETNKSLWTNGILALISAPLFYGMGTMLYSFY
    USA300_FPR3757  FLGNIFNNLYQYTASQDVVQRYQASDSLKETNKSLWTNGILALISAPLFYGMGTMLYSFY
                    ************************************************************

    COL             THEAVLPKGFNTSSVVPYFILTEMPPFVAGLLIAAIFAAAQSTISSSLNSISACISIDIK
    N315            THEAVLPKGFNTSSVVPYFILTEMPPFVAGLLIAAIFAAAQSTISSSLNSISACISIDIK
    NCTC8325        THEAVLPKGFNTSSVVPYFILTEMPPFVAGLLIAAIFAAAQSTISSSLNSISACISIDIK
    Newman          THEAVLPKGFNTSSVVPYFILTEMPPFVAGLLIAAIFAAAQSTISSSLNSISACISIDIK
    USA300_FPR3757  THEAVLPKGFNTSSVVPYFILTEMPPFVAGLLIAAIFAAAQSTISSSLNSISACISIDIK
                    ************************************************************

    COL             QRFFGKGSERHEVNFARFIIIIAGIFGFGMSLYLIASNSNDLWDLFLFVTGLFGVPLAGV
    N315            QRFFGKDSERHEVNFARFIIIIAGIFGFGMSLYLIASNSNDLWDLFLFVTGLFGVPLAGV
    NCTC8325        QRFFGKGSERHEVNFARFIIIIAGIFGFGMSLYLIASNSNDLWDLFLFVTGLFGVPLAGV
    Newman          QRFFGKGSERHEVNFARFIIIIAGIFGFGMSLYLIASNSNDLWDLFLFVTGLFGVPLAGV
    USA300_FPR3757  QRFFGKGSERHEVNFARFIIIIAGIFGFGMSLYLIASNSNDLWDLFLFVTGLFGVPLAGV
                    ******.*****************************************************

    COL             FAVGIFTKRTNTFGVICGLILGIIFAYVYNGVGKGNSPFYVSTISFTVAFVFAYILSFIV
    N315            FAVGIFTKRTNTFGVICGLILGIIFAYVYNGVGKGNSPFYVSTISFTVAFVFAYILSFIV
    NCTC8325        FAVGIFTKRTNTFGVICGLILGIIFAYVYNGVGKGNSPFYVSTISFTVAFVFAYILSFIV
    Newman          FAVGIFTKRTNTFGVICGLILGIIFAYVYNGVGKGNSPFYVSTISFTVAFVFAYILSFIV
    USA300_FPR3757  FAVGIFTKRTNTFGVICGLILGIIFAYVYNGVGKGNSPFYVSTISFTVAFVFAYILSFIV
                    ************************************************************

    COL             PSKHKKDITGLTIFEKDKPSTYISKTATKK
    N315            PSKHKKDITGLTIFEKDKPSTYISKTATNK
    NCTC8325        PSKHKKDITGLTIFEKDKPSTYISKTATKK
    Newman          PSKHKKDITGLTIFEKDKPSTYISKTATKK
    USA300_FPR3757  PSKHKKDITGLTIFEKDKPSTYISKTATKK
                    ****************************:*