From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001241000
  • symbol?: nanR
  • description?: RpiR family transcriptional regulator

      descriptions from strain specific annotations:

    • RpiR family transcriptional regulator
    • Sialic acid utilization regulator, RpiR family
    • helix-turn-helix domain, rpiR family protein
    • SIS domain protein
    • putative transcriptional regulator
    • RpiR family regulatory protein
  • strand?: -
  • coordinates?: 1526552..1527352
  • synteny block?: BlockID0007520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0316 (rpiR)
    08BA02176:
    C248_0306
    11819-97:
    MS7_0307
    71193:
    ST398NM01_0330
    ECT-R 2:
    ECTR2_277
    ED133:
    SAOV_0270
    ED98:
    SAAV_0284
    HO 5096 0412:
    SAEMRSA15_02730
    JH1:
    SaurJH1_0307
    JH9:
    SaurJH9_0300
    JKD6008:
    SAA6008_00293 (rpiR)
    JKD6159:
    SAA6159_00293 (rpiR)
    LGA251:
    SARLGA251_02790
    M013:
    M013TW_0298
    MRSA252:
    SAR0314
    MSHR1132:
    SAMSHR1132_02910
    MSSA476:
    SAS0294
    Mu3:
    SAHV_0314
    Mu50:
    SAV0317
    MW2:
    MW0294
    RF122:
    SAB0254c
    ST398:
    SAPIG0330
    T0131:
    SAT0131_00321 (sirB)
    TCH60:
    HMPREF0772_10178
    TW20:
    SATW20_03220
    USA300_TCH1516:
    USA300HOU_0337
    VC40:
    SAVC_01335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFENRVQRYQHLFTKTDKRIVNYIRQNGYSDAFSTINSLAHAIGTSPATMTRFSHKLDY
    N315            MKFENRVQRYQHLFTKTDKRIVNYIRQNGYSDAFSTINSLAHAIGTSPATMTRFSHKLDY
    NCTC8325        MKFENRVQRYQHLFTKTDKRIVNYIRQNGYSDAFSTINSLAHAIGTSPATMTRFSHKLDY
    Newman          MKFENRVQRYQHLFTKTDKRIVNYIRQNGYSDAFSTINSLAHAIGTSPATMTRFSHKLDY
    USA300_FPR3757  MKFENRVQRYQHLFTKTDKRIVNYIRQNGYSDAFSTINSLAHAIGTSPATMTRFSHKLDY
                    ************************************************************

    COL             ENFQDLKFNIQQEMTETVIENSPIIQRIHKYHQQIIQQTGEFIDNDIIQTFIDKLQSSRH
    N315            ENFQDLKFNIQQEMTETVIENSPIIQRIHKYHQQIIQQTGEFIDNDIIQTFIDKLQSSRH
    NCTC8325        ENFQDLKFNIQQEMTETVIENSPIIQRIHKYHQQIIQQTGEFIDNDIIQTFIDKLQSSRH
    Newman          ENFQDLKFNIQQEMTETVIENSPIIQRIHKYHQQIIQQTGEFIDNDIIQAFIDKLQSSRH
    USA300_FPR3757  ENFQDLKFNIQQEMTETVIENSPIIQRIHKYHQQIIQQTGEFIDNDIIQTFIDKLQSSRH
                    *************************************************:**********

    COL             ILFAGLGSSGLSATEFYYRMIRMGLKGNVTTDSHLMKISASLLSHSDMFIAMSNSGNTSE
    N315            ILFAGLGSSGLSATEFYYRMIRMGLKGNVTTDSHLMKISASLLSHSDMFIAMSNSGNTSE
    NCTC8325        ILFAGLGSSGLSATEFYYRMIRMGLKGNVTTDSHLMKISASLLSHSDMFIAMSNSGNTSE
    Newman          ILFAGLGSSGLSATEFYYRMIRMGLKGNVTTDSHLMKISASLLSHSDMFIAMSNSGNTSE
    USA300_FPR3757  ILFAGLGSSGLSATEFYYRMIRMGLKGNVTTDSHLMKISASLLSHSDMFIAMSNSGNTSE
                    ************************************************************

    COL             LISAAEVAKSHGAYVVAITNFEGSKLTDCADLVLLTTDQSRNTDHQFINTQIATLFLIDI
    N315            LISAAEVAKSHGAYVVAITNFEGSKLTDCADLVLLTTDQSRNTDHQFINTQIATLFLIDI
    NCTC8325        LISAAEVAKSHGAYVVAITNFEGSKLTDCADLVLLTTDQSRNTDHQFINTQIATLFLIDI
    Newman          LISAAEVAKSHGAYVVAITNFEGSKLTDCADLVLLTTDQSRNTDHQFINTQIATLFLIDI
    USA300_FPR3757  LISAAEVAKSHGAYVVAITNFEGSKLTDCADLVLLTTDQSRNTDHQFINTQIATLFLIDI
                    ************************************************************

    COL             VSYHLLENTNLSQTYQHTKSIILDNK
    N315            VSYHLLENTNLSQTYQHTKSIILDNK
    NCTC8325        VSYHLLENTNLSQTYQHTKSIILDNK
    Newman          VSYHLLENTNLSQTYQHTKSIILDNK
    USA300_FPR3757  VSYHLLENTNLSQTYQHTKSIILDNK
                    **************************