From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001831000
  • symbol?:
  • description?: phage major capsid protein

      descriptions from strain specific annotations:

    • phage major capsid protein
    • prophage L54a, major capsid protein
    • phiSLT ORF387-like protein
    • bacteriophage capsid protein
    • phage major capsid protein, HK97 family
    • phage major capsid protein HK97
    • phage protein
  • strand?: -
  • coordinates?: 2276138..2277301
  • synteny block?: BlockID0012070
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0352
    11819-97:
    MS7_1465
    71193:
    ECT-R 2:
    ED133:
    ED98:
    SAAV_2029
    HO 5096 0412:
    SAEMRSA15_13710
    JH1:
    SaurJH1_1082
    JH9:
    SaurJH9_1062
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR1516
    MSHR1132:
    MSSA476:
    SAS0935
    Mu3:
    Mu50:
    MW2:
    MW1398
    RF122:
    ST398:
    SAPIG0376
    T0131:
    TCH60:
    HMPREF0772_11693
    TW20:
    USA300_TCH1516:
    USA300HOU_1450
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPTLYELKQSLGMIGQQLKNKNDELSQKATDPNIDMEDIKQLETEKAGLQQRFNIVERQV
    NCTC8325        MPTLYELKQSLGMIGQQLKNKNDELSQKATDPNIDMEDIKQLETEKAGLQQRFNIVERQV
    USA300_FPR3757  MPTLYELKQSLGMIGQQLKNKNDELSQKATDPNIDMEDIKQLETEKAGLQQRFNIVERQV
                    ************************************************************

    COL             QDIEEKEKAKVKDKGEAYQSLSDNEKMVKAKAEFYRHAILPNEFEKPSMEAQRLLHALPT
    NCTC8325        QDIEEKEKAKVKDKGEAYQSLSDNEKMVKAKAEFYRHAILPNEFEKPSMEAQRLLHALPT
    USA300_FPR3757  QDIEEKEKAKVKDKGEAYQSLSDNEKMVKAKAEFYRHAILPNEFEKPSMEAQRLLHALPT
                    ************************************************************

    COL             GNDSGGDKLLPKTLSKEIVSEPFAKNQLREKARLTNIKGLEIPRVSYTLDDDDFITDVET
    NCTC8325        GNDSGGDKLLPKTLSKEIVSEPFAKNQLREKARLTNIKGLEIPRVSYTLDDDDFITDVET
    USA300_FPR3757  GNDSGGDKLLPKTLSKEIVSEPFAKNQLREKARLTNIKGLEIPRVSYTLDDDDFITDVET
                    ************************************************************

    COL             AKELKAKGDTVKFTTNKFKVFAAISDTVIHGSDVDLVNWVENALQSGLAAKERKDALAVS
    NCTC8325        AKELKAKGDTVKFTTNKFKVFAAISDTVIHGSDVDLVNWVENALQSGLAAKERKDALAVS
    USA300_FPR3757  AKELKAKGDTVKFTTNKFKVFAAISDTVIHGSDVDLVNWVENALQSGLAAKERKDALAVS
                    ************************************************************

    COL             PKSGLEHMSFYNGSVKEVEGADMYDAIINALADLHEDYRDNATIYMRYADYVKIISVLSN
    NCTC8325        PKSGLEHMSFYNGSVKEVEGADMYDAIINALADLHEDYRDNATIYMRYADYVKIISVLSN
    USA300_FPR3757  PKSGLEHMSFYNGSVKEVEGADMYDAIINALADLHEDYRDNATIYMRYADYVKIISVLSN
                    ************************************************************

    COL             GTTNFFDTPAEKVFGKPVVFTDAAVKPIVGDFNYFGINYDGTTYDTDKDVKKGEYLFVLT
    NCTC8325        GTTNFFDTPAEKVFGKPVVFTDAAVKPIVGDFNYFGINYDGTTYDTDKDVKKGEYLFVLT
    USA300_FPR3757  GTTNFFDTPAEKVFGKPVVFTDAAVKPIVGDFNYFGINYDGTTYDTDKDVKKGEYLFVLT
                    ************************************************************

    COL             AWYDQQRTLDSAFRIAKAKENTGPLPS
    NCTC8325        AWYDQQRTLDSAFRIAKAKENTGPLPS
    USA300_FPR3757  AWYDQQRTLDSAFRIAKAKENTGPLPS
                    ***************************