From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001862000
  • symbol?:
  • description?: aldehyde reductase

      descriptions from strain specific annotations:

    • aldehyde reductase
    • oxidoreductase
    • oxidoreductase family protein
    • putative oxidoreductase
    • 3-beta hydroxysteroid dehydrogenase/isomerase
    • NAD-dependent epimerase/dehydratase
    • NAD dependent epimerase/dehydratase family protein
    • oxidoreductase, putative
    • polysaccharide biosynthesis family protein
    • putative reductase
  • strand?: +
  • coordinates?: 2358152..2359180
  • synteny block?: BlockID0012360
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0327
    08BA02176:
    C248_0382
    11819-97:
    MS7_0318
    71193:
    ST398NM01_0409
    ECT-R 2:
    ECTR2_288
    ED133:
    ED98:
    SAAV_0296
    HO 5096 0412:
    SAEMRSA15_02840
    JH1:
    SaurJH1_0387
    JH9:
    SaurJH9_0377
    JKD6008:
    SAA6008_00305
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR0325
    MSHR1132:
    SAMSHR1132_03020
    MSSA476:
    SAS0305
    Mu3:
    SAHV_0325
    Mu50:
    SAV0328
    MW2:
    MW0305
    RF122:
    ST398:
    SAPIG0409
    T0131:
    SAT0131_00333
    TCH60:
    HMPREF0772_10167
    TW20:
    SATW20_03960
    USA300_TCH1516:
    USA300HOU_0349
    VC40:
    SAVC_01390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNKVLATGGTGFVGMRIISRLLEQGYDVQTTIRDLSKADKVIKTMQDNGISTERLMFVE
    N315            MNNKVLVTGGTGFVGMRIISRLLEQGYEVQTTIRDLSKADKVIKTMQDNGISTERLMFVE
    NCTC8325        MNNKVLVTGGTGFVGMRIISRLLEQGYDVQTTIRDLSKADKVIKTMQDNGISTERLMFVE
    Newman          MNNKVLATGGTGFVGMRIISRLLEQGYDVQTTIRDLSKADKVIKTMQDNGISTERLMFVE
    USA300_FPR3757  MNNKVLATGGTGFVGMRIISRLLEQGYDVQTTIRDLSKADKVIKTMQDNGISTERLMFVE
                    ******.********************:********************************

    COL             ADLSQDEHWDEAMKDCKYVLSVASPVFFGKTDDAEVMAKPAIEGIQRILRAAEHAGVKRV
    N315            ADLSQDEHWDEAMKDCKYVLSVASPVFFGKTDDAEVMAKPAIEGIQRILRAAEHAGVKRV
    NCTC8325        ADLSQDEHWDEAMKDCKYVLSVASPVFFGKTDDAEVMAKPAIEGIQRILRAAEHAGVKRV
    Newman          ADLSQDEHWDEAMKDCKYVLSVASPVFFGKTDDAEVMAKPAIEGIQRILRAAEHAGVKRV
    USA300_FPR3757  ADLSQDEHWDEAMKDCKYVLSVASPVFFGKTDDAEVMAKPAIEGIQRILRAAEHAGVKRV
                    ************************************************************

    COL             VMTANFGAVGFSNKDKNSITNESHWTNEDEPGLSVYEKSKLLAEKAAWDFVENENTTVEF
    N315            VMTANFGAVGFSNKDKNSITNESHWTNEDEPGLSVYEKSKLLAEKAAWDFVENENTIVEF
    NCTC8325        VMTANFGAVGFSNKDKNSITNESHWTNEDEPGLSVYEKSKLLAEKAAWDFVENENTTVEF
    Newman          VMTANFGAVGFSNKDKNSITNESHWTNEDEPGLSVYEKSKLLAEKAAWDFVENENTTVEF
    USA300_FPR3757  VMTANFGAVGFSNKDKNSITNESHWTNEDEPGLSVYEKSKLLAEKAAWDFVENENTTVEF
                    ******************************************************** ***

    COL             ATINPVAIFGPSLDAHVSGSFHLLENLLNGSMKRVPQIPLNVVDVRDVAELHILAMTNEQ
    N315            ATINPVAIFGPSLDAHVSGSFHLLENLLNGSMKRVPQIPLNVVDVRDVAELHILAMTNEQ
    NCTC8325        ATINPVAIFGPSLDAHVSGSFHLLENLLNGSMKRVPQIPLNVVDVRDVAELHILAMTNEQ
    Newman          ATINPVAIFGPSLDAHVSGSFHLLENLLNGSMKRVPQIPLNVVDVRDVAELHILAMTNEQ
    USA300_FPR3757  ATINPVAIFGPSLDAHVSGSFHLLENLLNGSMKRVPQIPLNVVDVRDVAELHILAMTNEQ
                    ************************************************************

    COL             ANGKRFIATADGQINLLEIAKLIKEKRPEIAQKVSTKKLPDFILSLGAKFNHQAKEGKLL
    N315            ANGKRFIATADGQINLLEIAKLIKEKRPEIAQKVSTKKLPDFILSLGAKFNHQAKEGKLL
    NCTC8325        ANGKRFIATADGQINLLEIAKLIKEKRPEIAQKVSTKKLPDFILSLGAKFNHQAKEGKLL
    Newman          ANGKRFIATADGQINLLEIAKLIKEKRPEIAQKVSTKKLPDFILSLGAKFNHQAKEGKLL
    USA300_FPR3757  ANGKRFIATADGQINLLEIAKLIKEKRPEIAQKVSTKKLPDFILSLGAKFNHQAKEGKLL
                    ************************************************************

    COL             LDMNRNVSNERAKTLLGWEPIATQEEAILAAVDSMAKYHLI
    N315            LDMNRNVSNERAKTLLGWEPIATQEEAILAAIDSMAKFHLI
    NCTC8325        LDMNRNVSNERAKTLLGWEPIATQEEAILAAVDSMAKYHLI
    Newman          LDMNRNVSNERAKTLLGWEPIATQEEAILAAVDSMAKYHLI
    USA300_FPR3757  LDMNRNVSNERAKTLLGWEPIATQEEAILAAVDSMAKYHLI
                    *******************************:*****:***