From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001882000
  • symbol?: fepA
  • description?: putative lipoprotein

      descriptions from strain specific annotations:

    • putative lipoprotein
    • Ferrous iron transport periplasmic protein EfeO
    • imelysin family protein
    • pseudogene
    • Lipoprotein
    • iron-binding lipoprotein
  • strand?: +
  • coordinates?: 2372842..2373696
  • synteny block?: BlockID0012560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0341 (efeO)
    08BA02176:
    C248_0398
    11819-97:
    MS7_0333
    71193:
    ST398NM01_0424
    ECT-R 2:
    ECTR2_303
    ED133:
    SAOV_0367
    ED98:
    SAAV_0311
    HO 5096 0412:
    SAEMRSA15_02980
    JH1:
    SaurJH1_0401
    JH9:
    SaurJH9_0391
    JKD6008:
    SAA6008_00320
    JKD6159:
    SAA6159_00317
    LGA251:
    SARLGA251_03030
    M013:
    M013TW_0322
    MRSA252:
    SAR0340
    MSHR1132:
    SAMSHR1132_03160
    MSSA476:
    SAS0319
    Mu3:
    SAHV_0340
    Mu50:
    SAV0343
    MW2:
    MW0319
    RF122:
    SAB0293
    ST398:
    SAPIG0424
    T0131:
    SAT0131_00348 (clpX)
    TCH60:
    HMPREF0772_10151
    TW20:
    SATW20_04110
    USA300_TCH1516:
    USA300HOU_0364
    VC40:
    SAVC_01465

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQATKAYDKYTDEQLNEFL
    N315            MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQATKAYDKYTDEQLNEFL
    NCTC8325        MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQATKAYDKYTDEQLNEFL
    Newman          MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQATKAYDKYTDEQLNEFL
    USA300_FPR3757  MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQATKAYDKYTDEQLNEFL
                    ************************************************************

    COL             KGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDPKIDARLADMKEEKKEK
    N315            KGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDPKIDARLADMKEEKKEK
    NCTC8325        KGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDPKIDARLADMKEEKKEK
    Newman          KGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDPKIDARLADMKEEKKEK
    USA300_FPR3757  KGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDPKIDARLADMKEEKKEK
                    ************************************************************

    COL             EWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTLDITPKLMLQGSVDLLNE
    N315            EWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTLDITPKLMLQGSVDLLNE
    NCTC8325        EWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTLDITPKLMLQGSVDLLNE
    Newman          EWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTLDITPKLMLQGSVDLLNE
    USA300_FPR3757  EWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTLDIIPKLMLQGSVDLLNE
                    ********************************************* **************

    COL             VATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKKDKKLSDDIQMNFDKVNQL
    N315            VATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKKDKKLSDDIQMNFDKVNQL
    NCTC8325        VATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKKDKKLSDDIQMNFDKVNQL
    Newman          VATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKKDKKLSDDIQMNFDKVNQL
    USA300_FPR3757  VATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKKDKKLSDDIQMNFDKVNQL
                    ************************************************************

    COL             LDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAVITE
    N315            LDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAVITE
    NCTC8325        LDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAVITE
    Newman          LDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAVITE
    USA300_FPR3757  LDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAVITE
                    ********************************************