From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0331 [new locus tag: SA_RS01900 ]
  • pan locus tag?: SAUPAN001882000
  • symbol: SA0331
  • pan gene symbol?: fepA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0331 [new locus tag: SA_RS01900 ]
  • symbol: SA0331
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 388964..389818
  • length: 855
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAAAAGTTAACAACGCTATTATTAGCATCAACGTTATTAATTGCTGCATGTGGGAAC
    GACGATAGTAAGAAGGATGATTCAAAGACATCGAAAAAAGATGATGGTGTTAAAGCAGAA
    TTAAAACAAGCAACAAAAGCATATGATAAATATACTGATGAACAGTTAAATGAATTTTTA
    AAAGGTACAGAAAAATTTGTTAAAGCGATTGAAAATAATGATATGGCCCAAGCAAAAGCG
    TTATATCCAAAAGTTCGTATGTATTATGAACGCTCTGAACCAGTTGCAGAAGCATTTGGA
    GATTTAGATCCTAAAATTGATGCACGTCTTGCAGATATGAAAGAAGAGAAAAAGGAAAAA
    GAATGGTCAGGATATCATAAGATTGAAAAAGCATTATACGAAGATAAGAAAATTGATGAT
    GTGACTAAAAAAGATGCACAACAATTATTGAAAGATGCAAAAGAATTGCATGCCAAAGCT
    GATACATTAGATATCACACCAAAATTAATGTTACAAGGTTCTGTTGACCTATTAAATGAA
    GTTGCAACTTCTAAAATCACAGGTGAAGAAGAAATTTATTCACATACAGATTTATATGAT
    TTTAAAGCGAACGTTGAAGGCGCACAAAAAATTTATGACTTATTTAAACCTATTTTAGAG
    AAAAAAGATAAAAAATTAAGTGATGATATTCAAATGAACTTCGATAAAGTGAATCAATTA
    TTGGATAAATATAAAGATAACAACGGCGGTTATGAGTCATTTGAAAAAGTATCGAAGAAA
    GACCGTAAAGCATTTGCGGATGCTGTTAATGCATTAGGAGAGCCACTAAGTAAAATGGCT
    GTGATTACTGAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    855

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0331 [new locus tag: SA_RS01900 ]
  • symbol: SA0331
  • description: hypothetical protein
  • length: 284
  • theoretical pI: 5.23329
  • theoretical MW: 32246.4
  • GRAVY: -0.808803

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    XXXCH domain (TIGR04358; HMM-score: 16.9)
  • TheSEED:  
    Iron acquisition and metabolismIron acquisition and metabolism - no subcategoryFerrous iron transporter EfeUOB, low-pH-induced Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain 
  • PFAM:
    no clan definedPeptidase_M75; Imelysin (PF09375; HMM-score: 126.8)
    Lipase_bact_N; Bacterial virulence factor lipase N-terminal (PF12262; HMM-score: 16.1)
    PCYCGC; Protein of unknown function with PCYCGC motif (PF13798; HMM-score: 15)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.8)
    Traffic (CL0147) Sec20; Sec20 (PF03908; HMM-score: 8.8)
    Transporter (CL0375) Pannexin_like; Pannexin-like TM region of LRRC8 (PF12534; HMM-score: 8.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 4.6
    • Cellwall Score: 2.48
    • Extracellular Score: 2.92
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: LIAACGN
  • SignalP: Signal peptide length 26 aa
    • Ymax: 0.401
    • Ymax_pos: 26
    • Cmax: 0.246
    • Cmax_pos: 26
    • Smax: 0.892
    • Smax_pos: 2
    • Smean: 0.711
    • D: 0.522
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQATKAYDKYTDEQLNEFLKGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDPKIDARLADMKEEKKEKEWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTLDITPKLMLQGSVDLLNEVATSKITGEEEIYSHTDLYDFKANVEGAQKIYDLFKPILEKKDKKLSDDIQMNFDKVNQLLDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAVITE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1329 (Fur*)
    Fur* (TF) important in Iron homeostasisRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]