From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001883000
  • symbol?: fepB
  • description?: deferrochelatase/peroxidase EfeB

      descriptions from strain specific annotations:

    • deferrochelatase/peroxidase EfeB
    • Dyp-type peroxidase
    • Tat-translocated protein
    • Dyp-type peroxidase family protein
    • iron (Fe2+)-dependent Dyp family peroxidase
    • tat-translocated enzyme
    • Ferrous iron transport peroxidase EfeB
    • iron-dependent peroxidase
    • pseudogene
    • putative Sec-independent exported protein
    • TAT-translocated Dyp-type peroxidase
  • strand?: +
  • coordinates?: 2373693..2374922
  • synteny block?: BlockID0012570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0342 (efeB)
    08BA02176:
    C248_0399
    11819-97:
    MS7_0334
    71193:
    ST398NM01_0425
    ECT-R 2:
    ECTR2_304
    ED133:
    SAOV_0368
    ED98:
    SAAV_0312
    HO 5096 0412:
    SAEMRSA15_02990
    JH1:
    SaurJH1_0402
    JH9:
    SaurJH9_0392
    JKD6008:
    SAA6008_00321
    JKD6159:
    SAA6159_00318
    LGA251:
    SARLGA251_03040
    M013:
    M013TW_0323
    MRSA252:
    SAR0341
    MSHR1132:
    SAMSHR1132_03170
    MSSA476:
    SAS0320
    Mu3:
    SAHV_0341
    Mu50:
    SAV0344
    MW2:
    MW0320
    RF122:
    SAB0294
    ST398:
    SAPIG0425
    T0131:
    SAT0131_00349 (tig)
    TCH60:
    HMPREF0772_10150
    TW20:
    SATW20_04120
    USA300_TCH1516:
    USA300HOU_0365
    VC40:
    SAVC_01470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNYEQVNDSTQFSRRTFLKMLGIGGAGVAIGASGVGSMWSFKSMFNTPEDPEKDAYEFY
    N315            --------------------------------------MWSFKSMFNTPEDPEKDAYEFY
    NCTC8325        MTNYEQVNDSTQFSRRTFLKMLGIGGAGVAIGASGVGSMWSFKSMFNTPEDPEKDAYEFY
    Newman          MTNYEQVNDSTQFSRRTFLKMLGIGGAGVAIGASGVGSMWSFKSMFNTPEDPEKDAYEFY
    USA300_FPR3757  MTNYEQVNDSTQFSRRTFLKMLGIGGAGVAIGASGVGSMWSFKSMFNTPEDPEKDAYEFY
                                                          **********************

    COL             GKVQPGITTPTQKTCNFVALDLKSKDRDAIKAMFKKWTVMADRMMDGDTVGKPSNNPLMP
    N315            GKVQPGITTPTQKTCNFVALDLKSKDRDAIKAMFKKWTVMADRMMDGDTVGKTSNNPLMP
    NCTC8325        GKVQPGITTPTQKTCNFVALDLKSKDRDAIKAMFKKWTVMADRMMDGDTVGKPSNNPLMP
    Newman          GKVQPGITTPTQKTCNFVALDLKSKDRDAIKAMFKKWTVMADRMMDGDTVGKPSNNPLMP
    USA300_FPR3757  GKVQPGITTPTQKTCNFVALDLKSKDRDAIKAMFKKWTVMADRMMDGDTVGKPSNNPLMP
                    ****************************************************.*******

    COL             PVDTGESIGLGASKLTITFGISKSLMKKIGLSSKIPDAFKDLPHFPNDQLIDDYSDGDIM
    N315            PVDTGESIGLGASKLTITFGISKSLMKKIGLSSKIPDAFKDLPHFPNDQLIDDYSDGDIM
    NCTC8325        PVDTGESIGLGASKLTITFGISKSLMKKIGLSSKIPDAFKDLPHFPNDQLIDDYSDGDIM
    Newman          PVDTGESIGLGASKLTITFGISKSLMKKIGLSSKIPDAFKDLPHFPNDQLIDDYSDGDIM
    USA300_FPR3757  PVDTGESIGLGASKLTITFGISKSLMKKIGLSSKIPDAFKDLPHFPNDQLIDDYSDGDIM
                    ************************************************************

    COL             IQACSNDSQVSFHAVHNLVRPFRDIVKVRWAQSGFISAKGKETPRNLMAFKDGTINPRKN
    N315            IQACSNDSQVSFHAVHNLVRPFRDIVKVRWAQSGFISAKGKETPRNLMAFKDGTINPRKS
    NCTC8325        IQACSNDSQVSFHAVHNLVRPFRDIVKVRWAQSGFISAKGKETPRNLMAFKDGTINPRKN
    Newman          IQACSNDSQVSFHAVHNLVRPFRDIVKVRWAQSGFISAKGKETPRNLMAFKDGTINPRKN
    USA300_FPR3757  IQACSNDSQVSFHAVHNLVRPFRDIVKVRWAQSGFISAKGKETPRNLMAFKDGTINPRKN
                    ***********************************************************.

    COL             NQLKDYVFIDDGWAKHGTYCVVRRIQIHIETWDRTALEEQEATFGRKRHSGAPLTGGKEF
    N315            NQLKDYVFIDDGWAKHGTYCVVRRIQIHIETWDRTALEEQEATFGRKRHSGAPLTGGKEF
    NCTC8325        NQLKDYVFIDDGWAKHGTYCVVRRIQIHIETWDRTALEEQEATFGRKRHSGAPLTGGKEF
    Newman          NQLKDYVFIDDGWAKHGTYCVVRRIQIHIETWDRTALEEQEATFGRKRHSGAPLTGGKEF
    USA300_FPR3757  NQLKDYVFIDDGWAKHGTYCVVRRIQIHIETWDRTALEEQEATFGRKRHSGAPLTGGKEF
                    ************************************************************

    COL             DEIDLKAKDSHGEYIIDKDAHTRLAKEANTSILRRAFNYVDGTDDRTGNFETGLLFIAFQ
    N315            DEIDLKAKDSHGEYIIDKDAHTRLAKEANTSILRRAFNYVDGTDDRTGNFETGLLFIAFQ
    NCTC8325        DEIDLKAKDSHGEYIIDKDAHTRLAKEANTSILRRAFNYVDGTDDRTGNFETGLLFIAFQ
    Newman          DEIDLKAKDSHGEYIIDKDAHTRLAKEANTSILRRAFNYVDGTDDRTGNFETGLLFIAFQ
    USA300_FPR3757  DEIDLKAKDSHGEYIIDKDAHTRLAKEANTSILRRAFNYVDGTDDRTGNFETGLLFIAFQ
                    ************************************************************

    COL             KATKQFIDIQNNLGSNDKLNEYITHRGSASFLVLPGVSKGGYLGETLFD
    N315            KATKQFIDIQNNLGSNDKLNEYITHRGSASFLVLPGVSKGGYLGETLFD
    NCTC8325        KATKQFIDIQNNLGSNDKLNEYITHRGSASFLVLPGVSKGGYLGETLFD
    Newman          KATKQFIDIQNNLGSNDKLNEYITHRGSASFLVLPGVSKGGYLGETLFD
    USA300_FPR3757  KATKQFIDIQNNLGSNDKLNEYITHRGSASFLVLPGVSKGGYLGETLFD
                    *************************************************