From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001884000
  • symbol?: fepC
  • description?: high-affinity iron transporter

      descriptions from strain specific annotations:

    • high-affinity iron transporter
    • Ferrous iron transport permease EfeU
    • OFeT family oxidase-dependent iron (Fe2+) transporter
    • Putative high-affinity Fe2+/Pb2+ permease-like protein
    • iron permease FTR1 family protein
    • pseudogene
    • High-affinity iron permease
  • strand?: +
  • coordinates?: 2374879..2376616
  • synteny block?: BlockID0012580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0343 (efeU)
    08BA02176:
    C248_0400
    11819-97:
    MS7_0335
    71193:
    ST398NM01_0426
    ECT-R 2:
    ECTR2_305
    ED133:
    SAOV_0369
    ED98:
    SAAV_0313
    HO 5096 0412:
    SAEMRSA15_03000
    JH1:
    SaurJH1_0403
    JH9:
    SaurJH9_0393
    JKD6008:
    SAA6008_00322
    JKD6159:
    SAA6159_00319
    LGA251:
    SARLGA251_03050
    M013:
    M013TW_0324
    MRSA252:
    SAR0342
    MSHR1132:
    SAMSHR1132_03180
    MSSA476:
    SAS0321
    Mu3:
    SAHV_0342
    Mu50:
    SAV0345
    MW2:
    MW0321
    RF122:
    SAB0295
    ST398:
    SAPIG0426
    T0131:
    SAT0131_00350
    TCH60:
    HMPREF0772_10149
    TW20:
    SATW20_04130
    USA300_TCH1516:
    USA300HOU_0366
    VC40:
    SAVC_01475

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MKHYLTKFVAMLITAAMVCSFGLLKSQAAEQQSISDVYSVITDAKSALSNNSISNDNKQ
    N315            MVKHYLTKFVAMLITAAMVCSFGLLKSQAAEQQSISDVYSVITDAKSALSNNSISNDNKQ
    NCTC8325        -----------MLITAAMVCSFGLLKSQAAEQQSISDVYSVITDAKSALSNNSISNDNKQ
    Newman          MVKHYLTKFVAMLITAAMVCSFGLLKSQAAEQQSISDVYSVITDAKSALSNNSISNDNKQ
    USA300_FPR3757  -----------MLITAAMVCSFGLLKSQAAEQQSISDVYSVITDAKSALSNNSISNDNKQ
                               *************************************************

    COL             KAIEQVVSAVKKLSLEDNSESNAVKSDVRKLEDAKANDNQKDTLSQLTKSLIAYEEKLAS
    N315            KAIEQVVSAVKKLSLEDNSEGNAVKSDVRKLEDAKANDNQKDTLSQLTKSLIAYEEKLAS
    NCTC8325        KAIEQVVSAVKKLSLEDNSESNAVKSDVRKLEDAKANDNQKDTLSQLTKSLIAYEEKLAS
    Newman          KAIEQVVSAVKKLSLEDNSESNAVKSDVRKLEDAKANDNQKDTLSQLTKSLIAYEEKLAS
    USA300_FPR3757  KAIEQVVSAVKKLSLEDNSESNAVKSDVRKLEDAKANDNQKDTLSQLTKSLIAYEEKLAS
                    ********************.***************************************

    COL             KDAGSKIKLLQQQVDAKDAAMTKAIKDKNKAELESLNNSLNQIWTSNETVIRNYDANQYG
    N315            KDAGSKIKLLQQQVDAKDAAMTKAIKDKNKAELESLNNSLNQIWTSNETVIRNYDANQYG
    NCTC8325        KDAGSKIKLLQQQVDAKDAAMTKAIKDKNKAELESLNNSLNQIWTSNETVIRNYDANQYG
    Newman          KDAGSKIKLLQQQVDAKDAAMTKAIKDKNKAELESLNNSLNQIWTSNETVIRNYDANQYG
    USA300_FPR3757  KDAGSKIKLLQQQVDAKDAAMTKAIKDKNKAELESLNNSLNQIWTSNETVIRNYDANQYG
                    ************************************************************

    COL             QIEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSNTSANDQYHVSQLNDALEK
    N315            QIEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSDTSANDQYHVSQLNDALEK
    NCTC8325        QIEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSNTSANDQYHVSQLNDALEK
    Newman          QIEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSNTSANDQYHVSQLNDALEK
    USA300_FPR3757  QIEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSNTSANDQYHVSQLNDALEK
                    *****************************************:******************

    COL             AIKAIDDNQLSDADAALTHFIETWPYVEGQIQTKDGALYTKIEDKIPYYQSVLDEHNKAH
    N315            AIKAIDDNQLSDADAALTHFIEIWPYVEGQIQTKDGALYTKIEDKIPYYQSVLDEHNKSH
    NCTC8325        AIKAIDDNQLSDADAALTHFIETWPYVEGQIQTKDGALYTKIEDKIPYYQSVLDEHNKAH
    Newman          AIKAIDDNQLSDADAALTHFIETWPYVEGQIQTKDGALYTKIEDKIPYYQSVLDEHNKAH
    USA300_FPR3757  AIKAIDDNQLSDADAALTHFIETWPYVEGQIQTKDGALYTKIEDKIPYYQSVLDEHNKAH
                    ********************** ***********************************:*

    COL             VKDGLVDLNNQIKEVVGHSYSFVDVMIIFLREGLEVLLIVMTLTTMTRNVKDKKGTASVI
    N315            VKDGLVDINNQIKEVVGHSYSFVDVMIIFLREGLEVLLIVMTLTTMTRKVKDNKGTASVI
    NCTC8325        VKDGLVDLNNQIKEVVGHSYSFVDVMIIFLREGLEVLLIVMTLTTMTRNVKDKKGTASVI
    Newman          VKDGLVDLNNQIKEVVGHSYSFVDVMIIFLREGLEVLLIVMTLTTMTRNVKDKKGTASVI
    USA300_FPR3757  VKDGLVDLNNQIKEVVGHSYSFVDVMIIFLREGLEVLLIVMTLTTMTRNVKDKKGTASVI
                    *******:****************************************:***:*******

    COL             GGAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVAVILMFIVGVWMHKRSNAKRWN
    N315            GGAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVAVILMFIVGVWMHKRSNAKRWN
    NCTC8325        GGAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVAVILMFIVGVWMHKRSNAKRWN
    Newman          GGAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVAVILMFIVGVWMHKRSNAKRWN
    USA300_FPR3757  GGAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVAVILMFIVGVWMHKRSNAKRWN
                    ************************************************************

    COL             DMIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFYMGMIGELATKDFIIGIALAIVI
    N315            DMIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFYMGMIGELATKDFIIGIALAIVI
    NCTC8325        DMIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFYMGMIGELATKDFIIGIALAIVI
    Newman          DMIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFYMGMIGELATKDFIIGIALAIVI
    USA300_FPR3757  DMIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFYMGMIGELATKDFIIGIALAIVI
                    ************************************************************

    COL             LIIFALLFRFIVKLIPIFYIFRVLSIFIFIMGFKMLGVSIQKLQLLGAMPRHVIEGFPTI
    N315            LIVFAVLFRFIVRLIPIFYIFRVLSIFIFIMGFKMLGVSIQKLQLLGAMPRHVIEGFPTI
    NCTC8325        LIIFALLFRFIVKLIPIFYIFRVLSIFIFIMGFKMLGVSIQKLQLLGAMPRHVIEGFPTI
    Newman          LIIFALLFRFIVKLIPIFYIFRVLSIFIFIMGFKMLGVSIQKLQLLGAMPRHVIEGFPTI
    USA300_FPR3757  LIIFALLFRFIVKLIPIFYIFRVLSIFIFIMGFKMLGVSIQKLQLLGAMPRHVIEGFPTI
                    **:**:******:***********************************************

    COL             NWLGFYPSYEPLIAQGAYIMVVAILIFKFKK
    N315            NWLGFYPSYEPLIAQAAYIMVVAILIFKFKK
    NCTC8325        NWLGFYPSYEPLIAQGAYIMVVAILIFKFKK
    Newman          NWLGFYPSYEPLIAQGAYIMVVAILIFKFKK
    USA300_FPR3757  NWLGFYPSYEPLIAQGAYIMVVAILIFKFKK
                    ***************.***************