From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001888000
  • symbol?: tatC
  • description?: Sec-independent periplasmic protein translocase

      descriptions from strain specific annotations:

    • Sec-independent periplasmic protein translocase
    • Twin-arginine translocation protein TatC
    • sec-independent translocase protein (TatC) family protein
    • MttB family protein
    • putative Sec-independent protein translocase protein
    • Sec-independent protein translocase TatC
    • Tat family twin arginine targeting transporter TatC
    • Twin arginine-targeting protein translocase TatC
    • sec-independent protein translocase protein
  • strand?: -
  • coordinates?: 2378653..2379132
  • synteny block?: BlockID0012610
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0344 (tatC)
    08BA02176:
    11819-97:
    MS7_0336 (tatC)
    71193:
    ST398NM01_2814
    ECT-R 2:
    ECTR2_306
    ED133:
    SAOV_0370c
    ED98:
    SAAV_0314
    HO 5096 0412:
    SAEMRSA15_03010
    JH1:
    SaurJH1_0404
    JH9:
    SaurJH9_0394
    JKD6008:
    SAA6008_00323 (tatC)
    JKD6159:
    SAA6159_00320 (tatC)
    LGA251:
    SARLGA251_03080
    M013:
    M013TW_0325
    MRSA252:
    SAR0343
    MSHR1132:
    SAMSHR1132_03190
    MSSA476:
    SAS0322
    Mu3:
    SAHV_0343
    Mu50:
    SAV0346
    MW2:
    MW0322
    RF122:
    SAB0296c
    ST398:
    T0131:
    SAT0131_00353
    TCH60:
    HMPREF0772_10148 (tatC)
    TW20:
    SATW20_04140
    USA300_TCH1516:
    USA300HOU_0367
    VC40:
    SAVC_01480

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MSFVITVIVVYVSSFWWMTPFITYITRAHVSLHAFSFTEMIQIYVMIIFFIAFCFISP
    N315            MLLSFVVTVIVVYVSSFWWMTPFITYITRAHVSLHAFSFTEMIQIYVMIIFFIAFCFISP
    NCTC8325        --MSFVITVIVVYVSSFWWMTPFITYITRAHVSLHAFSFTEMIQIYVMIIFFIAFCFISP
    Newman          --MSFVITVIVVYVSSFWWMTPFITYITRAHVSLHAFSFTEMIQIYVMIIFFIAFCFISP
    USA300_FPR3757  --MSFVITVIVVYVSSFWWMTPFITYITRAHVSLHAFSFTEMIQIYVMIIFFIAFCFISP
                      :***:*****************************************************

    COL             VMFYQLWAFIAPGLHNNERQFIYKYSFFSVLLFCAGVAFAFYVGFPMIIQFALKLSLTLN
    N315            VMFYQLWAFIAPGLHNNERQFIYKYSFFSVLLFCAGVAFAFYVGFPIIIQFALKLSLTLN
    NCTC8325        VMFYQLWAFIAPGLHNNERQFIYKYSFFSVLLFCAGVAFAFYVGFPMIIQFALKLSLTLN
    Newman          VMFYQLWAFIAPGLHNNERQFIYKYSFFSVLLFCAGVAFAFYVGFPMIIQFALKLSLTLN
    USA300_FPR3757  VMFYQLWAFIAPGLHNNERQFIYKYSFFSVLLFCAGVAFAFYVGFPMIIQFALKLSLTLN
                    **********************************************:*************

    COL             ISPVIGFKAYLIELIRWLFTFGLLFQLPILFMGLAKFGLIDTTSLKHYRKYIYFACFVLA
    N315            ISPVIGFKAYLVELIRWLFTFGILFQLPILFIGLAKFGLIDITSLKHYRKYIYFACFVLA
    NCTC8325        ISPVIGFKAYLIELIRWLFTFGLLFQLPILFMGLAKFGLIDTTSLKHYRKYIYFACFVLA
    Newman          ISPVIGFKAYLIELIRWLFTFGLLFQLPILFMGLAKFGLIDTTSLKHYRKYIYFACFVLA
    USA300_FPR3757  ISPVIGFKAYLIELIRWLFTFGLLFQLPILFMGLAKFGLIDTTSLKHYRKYIYFACFVLA
                    ***********:**********:********:********* ******************

    COL             SIIAPPDLTLNILLTLPLILLFEFSMFIVKFTCRGKPPTH
    N315            SIIAPPDLTLNILLTLPLILLFEFSMFIVKFTCRGKPPTH
    NCTC8325        SIIAPPDLTLNILLTLPLILLFEFSMFIVKFTCRGKPPTH
    Newman          SIIAPPDLTLNILLTLPLILLFEFSMFIVKFTCRGKPPTH
    USA300_FPR3757  SIIAPPDLTLNILLTLPLILLFEFSMFIVKFTCRGKPPTH
                    ****************************************