From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001890000
  • symbol?: tatA
  • description?: twin arginine-targeting protein translocase

      descriptions from strain specific annotations:

    • twin arginine-targeting protein translocase
    • mttA/Hcf106 family protein
    • Twin-arginine translocation protein TatA
    • twin arginine-targeting protein translocase, TatA/E family protein
    • twin arginine-targeting translocase, TatA/E family protein
    • mttA/Hcf106 family protein-like protein
    • Tat family twin arginine targeting transporter
    • putative Sec-independent protein translocaseprotein
    • twin-arginine translocation protein, TatA/E family subunit
    • MttA/Hcf106 family protein-related protein
    • Tat family twin arginine targeting transporter TatA
    • sec-independent protein translocase protein
    • protein translocase subunit
  • strand?: -
  • coordinates?: 2379371..2379592
  • synteny block?: BlockID0012630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0340 (tatA)
    USA300_FPR3757:
    04-02981:
    SA2981_0345 (tatA)
    08BA02176:
    C248_0402
    11819-97:
    MS7_0337 (tatA)
    71193:
    ST398NM01_0427
    ECT-R 2:
    ECTR2_308 (tatA)
    ED133:
    SAOV_0371c
    ED98:
    SAAV_0315
    HO 5096 0412:
    SAEMRSA15_03020
    JH1:
    SaurJH1_0405
    JH9:
    SaurJH9_0395
    JKD6008:
    SAA6008_00324 (tatA)
    JKD6159:
    SAA6159_00321 (tatA)
    LGA251:
    SARLGA251_03090
    M013:
    M013TW_0326
    MRSA252:
    SAR0344
    MSHR1132:
    SAMSHR1132_03200
    MSSA476:
    SAS0323
    Mu3:
    SAHV_0344
    Mu50:
    SAV0347
    MW2:
    MW0323
    RF122:
    SAB0297c
    ST398:
    SAPIG0427
    T0131:
    SAT0131_00354
    TCH60:
    HMPREF0772_10147 (tatA)
    TW20:
    SATW20_04150
    USA300_TCH1516:
    USA300HOU_0368
    VC40:
    SAVC_01485

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKES
    N315            ---MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKES
    NCTC8325        MIIMITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKES
    Newman          ---MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKES
    USA300_FPR3757  MIIMITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKES
                       *********************************************************

    COL             HDTPSKESKQQREQ
    N315            HDTPSKESKQQREQ
    NCTC8325        HDTPSKESKQQREQ
    Newman          HDTPSKESKQQREQ
    USA300_FPR3757  HDTPSKESKQQREQ
                    **************