From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001894000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC transporter family protein
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • multidrug ABC transporter ATPase
  • strand?: +
  • coordinates?: 2381299..2382147
  • synteny block?: BlockID0012670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0349
    08BA02176:
    C248_0406
    11819-97:
    MS7_0341
    71193:
    ST398NM01_0431
    ECT-R 2:
    ECTR2_312
    ED133:
    SAOV_0375
    ED98:
    SAAV_0319
    HO 5096 0412:
    SAEMRSA15_03060
    JH1:
    SaurJH1_0409
    JH9:
    SaurJH9_0399
    JKD6008:
    SAA6008_00328
    JKD6159:
    SAA6159_00325
    LGA251:
    SARLGA251_03130
    M013:
    M013TW_0330
    MRSA252:
    SAR0348
    MSHR1132:
    SAMSHR1132_03240
    MSSA476:
    SAS0327
    Mu3:
    SAHV_0348
    Mu50:
    SAV0351
    MW2:
    MW0327
    RF122:
    SAB0301
    ST398:
    SAPIG0431
    T0131:
    SAT0131_00358 (rplT)
    TCH60:
    HMPREF0772_10143
    TW20:
    SATW20_04190
    USA300_TCH1516:
    USA300HOU_0372
    VC40:
    SAVC_01505

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTLLNVDSVNKQYKDSDFKLQDASLTISTNETVGLIGKNGSGKSTLINILVGNRHKDNG
    N315            MTTLLNVDRVNKQYKDSDFKLQDASLTISTNETVGLIGKNGSGKSTLINILVGNRHKDNG
    NCTC8325        MTTLLNVDSVNKQYKDSDFKLQDASLTISTNETVGLIGKNGSGKSTLINILVGNRHKDNG
    Newman          MTTLLNVDSVNKQYKDSDFKLQDASLTISTNETVGLIGKNGSGKSTLINILVGNRHKDNG
    USA300_FPR3757  MTTLLNVDSVNKQYKDSDFKLQDASLTISTNETVGLIGKNGSGKSTLINILVGNRHKDNG
                    ******** ***************************************************

    COL             SITFFGEEHTVDDVEYKEHIGVVFDDLRVPNKLTIKDIDKVFQSIYMTWNSQKFFDLIKY
    N315            SIAFFGEEHAADDVEYKEHIGVVFDDLRVPNKLTIKDIDKVFQSIYTTWNSQKFFDLIKY
    NCTC8325        SITFFGEEHTVDDVEYKEHIGVVFDDLRVPNKLTIKDIDKVFQSIYMTWNSQKFFDLIKY
    Newman          SITFFGEEHTVDDVEYKEHIGVVFDDLRVPNKLTIKDIDKVFQSIYMTWNSQKFFDLIKY
    USA300_FPR3757  SITFFGEEHTVDDVEYKEHIGVVFDDLRVPNKLTIKDIDKVFQSIYMTWNSQKFFDLIKY
                    **:******:.*********************************** *************

    COL             FELPLQTKIKTFSRGMRMKIALTIALSHDVKLLILDEATAGMDVSGREEVMEILEDFVAQ
    N315            FELPLQTKIKTFSRGMRMKIALTIALSHDVKLLILDEATAGMDVSGREEVMELLEDFVAQ
    NCTC8325        FELPLQTKIKTFSRGMRMKIALTIALSHDVKLLILDEATAGMDVSGREEVMEILEDFVAQ
    Newman          FELPLQTKIKTFSRGMRMKIALTIALSHDVKLLILDEATAGMDVSGREEVMEILEDFVAQ
    USA300_FPR3757  FELPLQTKIKTFSRGMRMKIALTIALSHDVKLLILDEATAGMDVSGREEVMEILEDFVAQ
                    ****************************************************:*******

    COL             GGGILISSHISEDIEHLADKLVFMKDGRMILTEQKDILLAQYGIVTTEDKDVEIPKHLII
    N315            GGGILISSHISEDIEQLADKLVFMKDGRMILTEQKDILLAQYGIVTTGDKDVEIPKHLII
    NCTC8325        GGGILISSHISEDIEHLADKLVFMKDGRMILTEQKDILLAQYGIVTTEDKDVEIPKHLII
    Newman          GGGILISSHISEDIEHLADKLVFMKDGRMILTEQKDILLAQYGIVTTEDKDVEIPKHLII
    USA300_FPR3757  GGGILISSHISEDIEHLADKLVFMKDGRMILTEQKDILLAQYGIVTTEDKDVEIPKHLII
                    ***************:******************************* ************

    COL             ASRLSKGKYQILVKDYAEIENAEPLKHIDDATKIIMRGEV
    N315            ASRLSKGKYQILVKDYAEIENAEPLKHIDDATKIIMRGEV
    NCTC8325        ASRLSKGKYQILVKDYAEIENAEPLKHIDDATKIIMRGEV
    Newman          ASRLSKGKYQILVKDYAEIENAEPLKHIDDATKIIMRGEV
    USA300_FPR3757  ASRLSKGKYQILVKDYAEIENAEPLKHIDDATKIIMRGEV
                    ****************************************