From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001906000
  • symbol?: parB
  • description?: transcription terminator

      descriptions from strain specific annotations:

    • transcription terminator
    • parB-like partition protein
    • spoOJ protein
    • Chromosome (plasmid) partitioning protein ParB
    • stage 0 sporulation protein J
    • DNA-binding protein
    • ParB family chromosome partioning protein
    • chromosome partioning ParB family protein
    • ParB family partitioning protein
    • putative DNA-binding protein
    • chromosome/plasmid partitioning protein ParB
    • chromosome partitioning protein SpoOJ
    • Chromosome partitioning protein ParB
  • strand?: +
  • coordinates?: 2394144..2394995
  • synteny block?: BlockID0012790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0358 (parB)
    08BA02176:
    C248_0417 (parB)
    11819-97:
    MS7_0350 (spo0J)
    71193:
    ST398NM01_0440
    ECT-R 2:
    ECTR2_321
    ED133:
    SAOV_0384
    ED98:
    SAAV_0328
    HO 5096 0412:
    SAEMRSA15_03150
    JH1:
    SaurJH1_0419
    JH9:
    SaurJH9_0408
    JKD6008:
    SAA6008_00337 (parB)
    JKD6159:
    SAA6159_00334 (parB)
    LGA251:
    SARLGA251_03220
    M013:
    M013TW_0339
    MRSA252:
    SAR0357
    MSHR1132:
    SAMSHR1132_03330
    MSSA476:
    SAS0336
    Mu3:
    SAHV_0357
    Mu50:
    SAV0360
    MW2:
    MW0336
    RF122:
    SAB0311
    ST398:
    SAPIG0440
    T0131:
    SAT0131_00367 (lysP)
    TCH60:
    HMPREF0772_10134 (spoOJ)
    TW20:
    SATW20_04280
    USA300_TCH1516:
    USA300HOU_0381
    VC40:
    SAVC_01550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSELSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLNDLADSIKQYGILQPI
    N315            ---MSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLNDLADSIKQYGILQPI
    NCTC8325        MSELSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLNDLADSIKQYGILQPI
    Newman          MSELSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLNDLADSIKQYGILQPI
    USA300_FPR3757  MSELSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLNDLADSIKQYGILQPI
                       :********************************************************

    COL             VLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMELAVIENLQREDLNAIEE
    N315            VLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMELAVIENLQREDLNAIEE
    NCTC8325        VLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMELAVIENLQREDLNAIEE
    Newman          VLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMELAVIENLQREDLNAIEE
    USA300_FPR3757  VLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMELAVIENLQREDLNAIEE
                    ************************************************************

    COL             AESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIADMVKDGRLTSAHGRTLL
    N315            AESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIADMVKDGRLTSAHGRTLL
    NCTC8325        AESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIADMVKDGRLTSAHGRTLL
    Newman          AESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIADMVKDGRLTSAHGRTLL
    USA300_FPR3757  AESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIADMVKDGRLTSAHGRTLL
                    ************************************************************

    COL             AIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETDKVDITKPKFIKQQERQLR
    N315            AIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETDKVDITKPKFIKQQERQLR
    NCTC8325        AIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETDKVDITKPKFIKQQERQLR
    Newman          AIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETDKVDITKPKFIKQQERQLR
    USA300_FPR3757  AIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETDKVDITKPKFIKQQERQLR
                    ************************************************************

    COL             EQYGTKVDISIKKSVGKISFEFDSQEDFVRIIEQLNRRYGK
    N315            EQYGTKVDISIKKSVGKISFEFDSQDDFVRIIEQLNRRYGK
    NCTC8325        EQYGTKVDISIKKSVGKISFEFDSQEDFVRIIEQLNRRYGK
    Newman          EQYGTKVDISIKKSVGKISFEFDSQEDFVRIIEQLNRRYGK
    USA300_FPR3757  EQYGTKVDISIKKSVGKISFEFDSQEDFVRIIEQLNRRYGK
                    *************************:***************