From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001907000
  • symbol?:
  • description?: Potassium efflux system KefA protein / Small-conductance mechanosensitive channel

      descriptions from strain specific annotations:

    • Potassium efflux system KefA protein / Small-conductance mechanosensitive channel
    • mechanosensitive ion channel family protein
    • transporter, small conductance mechanosensitive ion channel (MscS) family
    • Mechanosensitive ion channel
    • MscS family small conductance mechanosensitive ion channel protein
  • strand?: +
  • coordinates?: 2395152..2396033
  • synteny block?: BlockID0012800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0359 (kefA)
    08BA02176:
    C248_0418
    11819-97:
    MS7_0351
    71193:
    ST398NM01_0441
    ECT-R 2:
    ECTR2_322
    ED133:
    SAOV_0385
    ED98:
    SAAV_0329
    HO 5096 0412:
    SAEMRSA15_03160
    JH1:
    SaurJH1_0420
    JH9:
    SaurJH9_0409
    JKD6008:
    SAA6008_00338
    JKD6159:
    SAA6159_00335
    LGA251:
    SARLGA251_03230
    M013:
    M013TW_0340
    MRSA252:
    SAR0358
    MSHR1132:
    SAMSHR1132_03340
    MSSA476:
    SAS0337
    Mu3:
    SAHV_0358
    Mu50:
    SAV0361
    MW2:
    MW0337
    RF122:
    SAB0312
    ST398:
    SAPIG0441
    T0131:
    SAT0131_00369 (thrS)
    TCH60:
    HMPREF0772_10133
    TW20:
    SATW20_04290
    USA300_TCH1516:
    USA300HOU_0382
    VC40:
    SAVC_01555

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQVMNIISSLFEPLTKIETYENIATKIAMIVIYIIVALIVIKILNKMIEQGFKIQNKSK
    N315            MDQVMSIISSLFEPLTKIETYENIATKIAMIVIYIIVALIVIKILNKMIEQGFKIQNKSK
    NCTC8325        MNQVMNIISSLFEPLTKIETYENIATKIAMIVIYIIVALIVIKILNKMIEQGFKIQNKSK
    Newman          MNQVMNIISSLFEPLTKIETYENIATKIAMIVIYIIVALIVIKILNKMIEQGFKIQNKSK
    USA300_FPR3757  MNQVMNIISSLFEPLTKIETYENIATKIAMIVIYIIVALIVIKILNKMIEQGFKIQNKSK
                    *:***.******************************************************

    COL             KSNKKRSKTLISLVQNVVKYIVWFIVITTILSKFGISVEGVIASAGVVGLAVGFGAQTIV
    N315            KSNKKRSKTLISLVQNVVKYIVWFIVITTILSKFGISVEGVIASAGVVGLAVGFGAQTIV
    NCTC8325        KSNKKRSKTLISLVQNVVKYIVWFIVITTILSKFGISVEGVIASAGVVGLAVGFGAQTIV
    Newman          KSNKKRSKTLISLVQNVVKYIVWFIVITTILSKFGISVEGVIASAGVVGLAVGFGAQTIV
    USA300_FPR3757  KSNKKRSKTLISLVQNVVKYIVWFIVITTILSKFGISVEGVIASAGVVGLAVGFGAQTIV
                    ************************************************************

    COL             KDVITGFFIIFESQFDVGDYVKINNGGTTVAEGTVKSIGLRSTRINTISGELTILPNSSM
    N315            KDVITGFFIIFESQFDVGDYVKINNGGTTVAEGTVKSIGLRSTRINTISGELTILPNSSM
    NCTC8325        KDVITGFFIIFESQFDVGDYVKINNGGTTVAEGTVKSIGLRSTRINTISGELTILPNSSM
    Newman          KDVITGFFIIFESQFDVGDYVKINNGGTTVAEGTVKSIGLRSTRINTISGELTILPNSSM
    USA300_FPR3757  KDVITGFFIIFESQFDVGDYVKINNGGTTVAEGTVKSIGLRSTRINTISGELTILPNSSM
                    ************************************************************

    COL             GEITNYSITNGTAIVKIPVSVEENIDNVDKKLNKLFTSLRSKYYLFVSDPVVIGIDAIED
    N315            GEITNYSITNGTAIVKIPVSVDENIDNVEKKLNKLFTSLRSKYYLFVSDPVVIGIDAFED
    NCTC8325        GEITNYSITNGTAIVKIPVSVEENIDNVDKKLNKLFTSLRSKYYLFVSDPVVIGIDAIED
    Newman          GEITNYSITNGTAIVKIPVSVEENIDNVDKKLNKLFTSLRSKYYLFVSDPVVIGIDAIED
    USA300_FPR3757  GEITNYSITNGTAIVKIPVSVEENIDNVDKKLNKLFTSLRSKYYLFVSDPVVIGIDAIED
                    *********************:******:****************************:**

    COL             TRVILRISAETIPGEGFAGARIIRKEVQKMFLQEGIKTPQPIMTAYNHSENGV
    N315            TRVILRVSAETIPGEGFSGARIIRKEVQKMFLQEGIKTPQPIMTPFNHSENGV
    NCTC8325        TRVILRISAETIPGEGFAGARIIRKEVQKMFLQEGIKTPQPIMTAYNHSENGV
    Newman          TRVILRISAETIPGEGFAGARIIRKEVQKMFLQEGIKTPQPIMTAYNHSENGV
    USA300_FPR3757  TRVILRISAETIPGEGFAGARIIRKEVQKMFLQEGIKTPQPIMTAYNHSENGV
                    ******:**********:**************************.:*******