From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001975000
  • symbol?:
  • description?: phosphoglycerate mutase Gpm3p

      descriptions from strain specific annotations:

    • phosphoglycerate mutase Gpm3p
    • phosphoglycerate mutase family protein
    • truncated phosphoglycerate mutase family protein
    • putative phosphoglycerate mutase family protein
    • histidine phosphatase super family protein
  • strand?: +
  • coordinates?: 2444006..2444611
  • synteny block?: BlockID0013280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0375
    08BA02176:
    C248_0431
    11819-97:
    MS7_0366
    71193:
    ST398NM01_0453
    ECT-R 2:
    ECTR2_336
    ED133:
    SAOV_0399
    ED98:
    SAAV_0343
    HO 5096 0412:
    SAEMRSA15_03290
    JH1:
    SaurJH1_0435
    JH9:
    SaurJH9_0424
    JKD6008:
    SAA6008_00376
    JKD6159:
    SAA6159_00350
    LGA251:
    SARLGA251_03370
    M013:
    M013TW_0355
    MRSA252:
    SAR0394
    MSHR1132:
    SAMSHR1132_03480
    MSSA476:
    SAS0353
    Mu3:
    SAHV_0373
    Mu50:
    SAV0376
    MW2:
    MW0351
    RF122:
    SAB0326
    ST398:
    SAPIG0453
    T0131:
    SAT0131_00408 (ald2)
    TCH60:
    HMPREF0772_10119
    TW20:
    SATW20_04430
    USA300_TCH1516:
    USA300HOU_0399
    VC40:
    SAVC_01635

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQI
    N315            MHKVRSNIMTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQI
    NCTC8325        --------MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQI
    Newman          --------MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQI
    USA300_FPR3757  --------MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQI
                            ****************************************************

    COL             KHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDP
    N315            KHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDP
    NCTC8325        KHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDP
    Newman          KHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDP
    USA300_FPR3757  KHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDP
                    ************************************************************

    COL             NFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFN
    N315            NFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFN
    NCTC8325        NFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFN
    Newman          NFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFN
    USA300_FPR3757  NFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFN
                    ************************************************************

    COL             KVSRAEAVDLKVENCKPYIIE
    N315            KVSREEAVDLKVENCKPYIIE
    NCTC8325        KVSRAEAVDLKVENCKPYIIE
    Newman          KVSRAEAVDLKVENCKPYIIE
    USA300_FPR3757  KVSRAEAVDLKVENCKPYIIE
                    **** ****************