From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001976000
  • symbol?:
  • description?: membrane spanning protein
  • strand?: -
  • coordinates?: 2444677..2445060
  • synteny block?: BlockID0013290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0376
    08BA02176:
    C248_0432
    11819-97:
    MS7_0367
    71193:
    ST398NM01_0454
    ECT-R 2:
    ECTR2_337
    ED133:
    SAOV_0400c
    ED98:
    SAAV_0344
    HO 5096 0412:
    SAEMRSA15_03300
    JH1:
    SaurJH1_0436
    JH9:
    SaurJH9_0425
    JKD6008:
    SAA6008_00377
    JKD6159:
    SAA6159_00351
    LGA251:
    SARLGA251_03380
    M013:
    M013TW_0356
    MRSA252:
    SAR0395
    MSHR1132:
    SAMSHR1132_03490
    MSSA476:
    SAS0354
    Mu3:
    SAHV_0374
    Mu50:
    SAV0377
    MW2:
    MW0352
    RF122:
    SAB0327c
    ST398:
    SAPIG0454
    T0131:
    SAT0131_00409
    TCH60:
    HMPREF0772_10118
    TW20:
    SATW20_04440
    USA300_TCH1516:
    USA300HOU_0400
    VC40:
    SAVC_01640

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MKVRITFIILAILSTIVCLFLAAMHPTGPNTVTFEQPYLFTLNIIIMVLVALPSLVL
    N315            ---MKVRITFIILAILSTIVCLFLAAMYPTGPNTVTFEQPYLFTLNIILMVLVALPSLVL
    NCTC8325        ---MKVRITFIILAILSTIVCLFLAAMHPTGPNTVTFEQPYLFTLNIIIMVLVALPSLVL
    Newman          MIMMKVRITFIILAILSTIVCLFLAAMHPTGPNTVTFEQPYLFTLNIIIMVLVALPSLVL
    USA300_FPR3757  ---MKVRITFIILAILSTIVCLFLAAMHPTGPNTVTFEQPYLFTLNIIIMVLVALPSLVL
                       ************************:********************:***********

    COL             AIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSIILFTSTIITLAIG
    N315            AIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSIILFISAIITLAIG
    NCTC8325        AIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSIILFTSTIITLAIG
    Newman          AIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSIILFTSTIITLAIG
    USA300_FPR3757  AIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSIILFTSTIITLAIG
                    ************************************************** *:*******

    COL             GKSVEKNDSP
    N315            GKSVDKNDSH
    NCTC8325        GKSVEKNDSP
    Newman          GKSVEKNDSP
    USA300_FPR3757  GKSVEKNDSP
                    ****:****