From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002056000
  • symbol?:
  • description?: MazF/PemK family toxin

      descriptions from strain specific annotations:

    • MazF/PemK family toxin
    • PemK-like protein
    • Phage protein
    • pseudogene
  • strand?: -
  • coordinates?: 2538863..2539571
  • synteny block?: BlockID0013780
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0391
    08BA02176:
    C248_0466
    11819-97:
    71193:
    ST398NM01_0485
    ECT-R 2:
    ECTR2_352
    ED133:
    SAOV_0433c
    ED98:
    SAAV_0360
    HO 5096 0412:
    JH1:
    SaurJH1_0451
    JH9:
    SaurJH9_0440
    JKD6008:
    SAA6008_00417
    JKD6159:
    SAA6159_00367
    LGA251:
    SARLGA251_03530
    M013:
    MRSA252:
    SAR0412
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0414
    Mu50:
    SAV0417
    MW2:
    RF122:
    ST398:
    SAPIG0485
    T0131:
    SAT0131_00452
    TCH60:
    HMPREF0772_10100
    TW20:
    SATW20_04900
    USA300_TCH1516:
    USA300HOU_0416
    VC40:
    SAVC_01715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKNINQANSKLNTSNKKLKQAYSKSDSKNMKVIYMPHWLEFYSIAIHSDVTSNKKRYYK
    N315            MSKNINQANSKLNTSNKKLKQAYSKSDSKNMKVIYMPHWLEFYSIAIHSDVTSNKKRYYK
    NCTC8325        MSKNINQANSKLNTSNKKLKQAYSKSDSKNMKVIYMPHWLEFYSIAIHSDVTSNKKRYYK
    Newman          MSKNINQANSKLNTSNKKLKQAYSKSDSKNMKVIYMPHWLEFYSIAIHSDVTSNKKRYYK
    USA300_FPR3757  MSKNINQANSKLNTSNKKLKQAYSKSDSKNMKVIYMPHWLEFYSIAIHSDVTSNKKRYYK
                    ************************************************************

    COL             SYSRGTVVYVKLGSNIGSEFSGNHFCVILDNKDNKGKETVTIVPLSSKGNKNYLKLNESV
    N315            SFSRGTVVYVKLGSNIGSEFSGNHFCVILDNKDNKGKETVTIVPLSSKGNKNYLKLNESV
    NCTC8325        SYSRGTVVYVKLGSNIGSEFSGNHFCVILDNKDNKGKETVTIVPLSSKGNKNYLKLNESV
    Newman          SYSRGTVVYVKLGSNIGSEFSGNHFCVILDNKDNKGKETVTIVPLSSKGNKNYLKLNESV
    USA300_FPR3757  SYSRGTVVYVKLGSNIGSEFSGNHFCVILDNKDNKGKETVTIVPLSSKGNKNYLKLNESV
                    *:**********************************************************

    COL             LNLTATDLKKQIIDISSKVQALAQKYREIDIKLSTEDKKLLSNLNQKANELYRVIGVYSK
    N315            LNLTATDLKKQIIDISSKVQALTQKYRDIDIKLSTEDKKLLSNLNQKANELYRVIGVYSK
    NCTC8325        LNLTATDLKKQIIDISSKVQALAQKYREIDIKLSTEDKKLLSNLNQKANELYRVIGVYSK
    Newman          LNLTATDLKKQIIDISSKVQALAQKYREIDIKLSTEDKKLLSNLNQKANELYRVIGVYSK
    USA300_FPR3757  LNLTATDLKKQIIDISSKVQALAQKYREIDIKLSTEDKKLLSNLNQKANELYRVIGVYSK
                    **********************:****:********************************

    COL             HKGKDTYVNISAITTISKRRISKINDSDPTGTIIISEDDMNEIEKQLKIKFFSN
    N315            HKGKDTYVNISAITTISKRRISKINDSDPTGTIIISEDDMNEIEKQLKIKFFSN
    NCTC8325        HKGKDTYVNISAITTISKRRISKINDSDPTGTIIISEDDMNEIEKQLKIKFFSN
    Newman          HKGKDTYVNISAITTISKRRISKINDSDPTGTIIISEDDMNEIEKQLKIKFFSN
    USA300_FPR3757  HKGKDTYVNISAITTISKRRISKINDSDPTGTIIISEDDMNEIEKQLKIKFFSN
                    ******************************************************