From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002113000
  • symbol?: ssl7
  • description?: staphylococcal superantigen-like protein 7

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 7
    • superantigen-like protein 7
    • exotoxin 1
    • Exotoxin 11
    • exotoxin 5
    • staphylococcal/Streptococcal toxin, beta-grasp domain protein
    • Staphylococcal enterotoxin-like toxin
    • staphylococcal exotoxin
  • strand?: +
  • coordinates?: 2601159..2601854
  • synteny block?: BlockID0014190
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0387 (set11)
    NCTC8325:
    Newman:
    NWMN_0394 (set7nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0402 (set11)
    08BA02176:
    C248_0479 (set1)
    11819-97:
    MS7_0402
    71193:
    ST398NM01_0496
    ECT-R 2:
    ECTR2_362
    ED133:
    SAOV_0447
    ED98:
    SAAV_0370
    HO 5096 0412:
    SAEMRSA15_03580 (set1)
    JH1:
    SaurJH1_0462
    JH9:
    SaurJH9_0450
    JKD6008:
    SAA6008_00430 (set11)
    JKD6159:
    LGA251:
    SARLGA251_03650 (set1)
    M013:
    M013TW_0388
    MRSA252:
    SAR0428 (set1)
    MSHR1132:
    SAMSHR1132_03760
    MSSA476:
    SAS0390
    Mu3:
    SAHV_0424 (set11)
    Mu50:
    SAV0426 (set11)
    MW2:
    MW0388 (set22)
    RF122:
    SAB0380 (set5)
    ST398:
    SAPIG0496
    T0131:
    SAT0131_00466
    TCH60:
    HMPREF0772_10089 (set1)
    TW20:
    SATW20_05030 (set1)
    USA300_TCH1516:
    USA300HOU_0429 (set22)
    VC40:
    SAVC_01765

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNI
    NCTC8325        MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNI
    Newman          MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNI
    USA300_FPR3757  MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNI
                    ****************************:*****************:*************

    N315            SGKVENYNGSNVVRFNQEKQNHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVG
    NCTC8325        SGKVENYNGSNVVRFNQENQNHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVG
    Newman          SGKVENYNGSNVVRFNQENQNHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVG
    USA300_FPR3757  SGKVENYNGSNVVRFNQENQNHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVG
                    ******************:************:***:*:**::******************

    N315            GVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEVSLKELDFKIRKQLVEKYGLY
    NCTC8325        GVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEVSLKELDFKIRQHLVKNYGLY
    Newman          GVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEVSLKELDFKIRQHLVKNYGLY
    USA300_FPR3757  GVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEVSLKELDFKIRQHLVKNYGLY
                    ********************************* ****************::**::****

    N315            KGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI
    NCTC8325        KGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI
    Newman          KGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI
    USA300_FPR3757  KGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI
                    *************** :*: *********************::* **::**