From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002114000
  • symbol?: ssl8
  • description?: staphylococcal superantigen-like protein 8
  • strand?: +
  • coordinates?: 2602198..2615732
  • synteny block?: BlockID0014200
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0388 (set12)
    NCTC8325:
    Newman:
    NWMN_0395 (set8nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0403 (set12)
    08BA02176:
    11819-97:
    MS7_0403
    71193:
    ECT-R 2:
    ECTR2_363
    ED133:
    SAOV_0448
    ED98:
    SAAV_0371
    HO 5096 0412:
    JH1:
    SaurJH1_0463
    JH9:
    SaurJH9_0451
    JKD6008:
    SAA6008_00431 (set12)
    JKD6159:
    LGA251:
    SARLGA251_03660
    M013:
    M013TW_0389
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0391
    Mu3:
    SAHV_0425 (set12)
    Mu50:
    SAV0427 (set12)
    MW2:
    MW0389 (set23)
    RF122:
    SAB0381 (set4)
    ST398:
    T0131:
    SAT0131_00467 (serA)
    TCH60:
    TW20:
    SATW20_05040
    USA300_TCH1516:
    USA300HOU_0430 (set23)
    VC40:
    SAVC_01770

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKFTAIAKAIFVLGILTTSVMITENQSVNAKGKYEKMNRLYDTNKLHQYYSGPSYELTNV
    NCTC8325        MKFTVIAKAIFILGILTTSVMITENQSVNAKGKYEKMNRLYDTNKLHQYYSGPSYELTNV
    Newman          MKFTVIAKAIFILGILTTSVMITENQSVNAKGKYEKMNRLYDTNKLHQYYSGPSYELTNV
    USA300_FPR3757  MKFTVIAKAIFILGILTTSVMITENQSVNAKGKYEKMNRLYDTNKLHQYYSGPSYELTNV
                    ****.******:************************************************

    N315            SGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVS
    NCTC8325        SGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVS
    Newman          SGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVS
    USA300_FPR3757  SGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLDVFAVPELVDLDGRIFSVS
                    ************************************************************

    N315            GVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKY
    NCTC8325        GVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKY
    Newman          GVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKY
    USA300_FPR3757  GVTKKNVKSIFESLRTPNLLVKKIDDKDGFSIDEFFFIQKEEVSLKELDFKIRKLLIKKY
                    ************************************************************

    N315            KLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK
    NCTC8325        KLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK
    Newman          KLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK
    USA300_FPR3757  KLYEGSADKGRIVINMKDENKYEIDLSDKLDFERMADVINSEQIKNIEVNLK
                    ****************************************************