From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002118000
  • symbol?: ssl9
  • description?: staphylococcal superantigen-like protein 9

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 9
    • superantigen-like protein
    • enterotoxin-like toxin
    • Exotoxin 13
    • exotoxin 5
    • staphylococcal/Streptococcal toxin, beta-grasp domain protein
    • Staphylococcal enterotoxin-like toxin
    • staphylococcal exotoxin
    • superantigen-like protein, exotoxin 13
  • strand?: +
  • coordinates?: 2609474..2610401
  • synteny block?: BlockID0014240
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0389 (set13)
    NCTC8325:
    Newman:
    NWMN_0396 (set9nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0404 (set13)
    08BA02176:
    C248_0480 (set5)
    11819-97:
    MS7_0404
    71193:
    ST398NM01_0497
    ECT-R 2:
    ECTR2_364
    ED133:
    SAOV_0449
    ED98:
    SAAV_0372
    HO 5096 0412:
    SAEMRSA15_03590 (set5)
    JH1:
    SaurJH1_0464
    JH9:
    SaurJH9_0452
    JKD6008:
    SAA6008_00432 (set13)
    JKD6159:
    LGA251:
    SARLGA251_03670 (set5)
    M013:
    M013TW_0390
    MRSA252:
    SAR0429 (set5)
    MSHR1132:
    MSSA476:
    SAS0392
    Mu3:
    SAHV_0426 (set13)
    Mu50:
    SAV0428 (set13)
    MW2:
    MW0390 (set24)
    RF122:
    SAB0382 (set3)
    ST398:
    SAPIG0497
    T0131:
    SAT0131_00468
    TCH60:
    HMPREF0772_10088 (set5)
    TW20:
    SATW20_05050 (set5)
    USA300_TCH1516:
    USA300HOU_0431 (set24)
    VC40:
    SAVC_01775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNI
    N315            MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNI
    NCTC8325        MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNI
    Newman          MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNI
    USA300_FPR3757  MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNI
                    ****::*******************:: ****************************.***

    COL             SVKSEDYYGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVG
    N315            SVKSEDYYGSNVLNFNQRNKTFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVG
    NCTC8325        SVKSEDYYGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVG
    Newman          SVKSEDYYGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVG
    USA300_FPR3757  SVKSEDYYGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVG
                    ***************:****:***************************************

    COL             GITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQKEEVSLKELDFKIRKLLIEKY
    N315            GITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQKEEVSLKELDFKIRKMLVEKY
    NCTC8325        GITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQKEEVSLKELDFKIRKLLIEKY
    Newman          GITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQKEEVSLKELDFKIRKLLIEKY
    USA300_FPR3757  GITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQKEEVSLKELDFKIRKLLIEKY
                    ***************************:**************************:*:***

    COL             RLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN
    N315            RLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN
    NCTC8325        RLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN
    Newman          RLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN
    USA300_FPR3757  RLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN
                    *****:***************: *********:*******************