From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002135000
  • symbol?: lpl9
  • description?: tandem-type lipoprotein

      descriptions from strain specific annotations:

    • tandem-type lipoprotein
    • tandem lipoprotein
    • Membrane lipoprotein
    • putative lipoprotein
    • staphylococcal tandem lipoprotein
    • staphylococcus tandem lipoprotein
    • staphylococcus tandem lipoproteins family protein
    • Tandem lipoprotein within Pathogenicity island 2
  • strand?: +
  • coordinates?: 2627167..2627949
  • synteny block?: BlockID0014410
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0397 (lpl2)
    NCTC8325:
    Newman:
    NWMN_0412 (lpl9nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0413 (lpl2)
    08BA02176:
    C248_0488
    11819-97:
    MS7_0411
    71193:
    ST398NM01_0504
    ECT-R 2:
    ECTR2_372
    ED133:
    ED98:
    SAAV_0380
    HO 5096 0412:
    SAEMRSA15_03660
    JH1:
    SaurJH1_0472
    JH9:
    SaurJH9_0460
    JKD6008:
    SAA6008_00448 (lpl2)
    JKD6159:
    LGA251:
    SARLGA251_03740
    M013:
    MRSA252:
    SAR0438
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0435 (lpl2)
    Mu50:
    SAV0437 (lpl2)
    MW2:
    RF122:
    ST398:
    SAPIG0504
    T0131:
    SAT0131_00483
    TCH60:
    HMPREF0772_10081
    TW20:
    SATW20_05140
    USA300_TCH1516:
    USA300HOU_0447
    VC40:
    SAVC_01820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPI
    N315            -MGYLKKLALFISVIILGIFIIGCDSSSDTAEKA----KEDSKEEQIKKSFAKTLDMYPI
    NCTC8325        --------------------------MKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPI
    Newman          -MEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPI
    USA300_FPR3757  -MEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPI
                                               .*  :*     * ********************

    COL             KNLEDLYDKEGYRDGEFKKGDKGTWTILTGFSKSNKPGVLDDEGMVLYLNRNTKKATGYY
    N315            KNLEDLYDKEGYRDGEFKKGDKGTWTLLTSFSKSNKPGEIDDEGMVLYLNRNTKKATGYY
    NCTC8325        KNLEDLYDKEGYRDGEFKKGDKGTWTILTGFSKSNKPGVLDDEGMVLYLNRNTKKATGYY
    Newman          KNLEDLYDKEGYRDGEFKKGDKGTWTILTGFSKSNKPGVLDDEGMVLYLNRNTKKATGYY
    USA300_FPR3757  KNLEDLYDKEGYRDGEFKKGDKGTWTILTGFSKSNKPGVLDDEGMVLYLNRNAKKATGYY
                    **************************:**.******** :************:*******

    COL             FVNKVYDDISKNHNEKKYRVELKNNKIVLLDNVEDKKLKQKIENFKFFSQYADFKDLKNY
    N315            FVNKIYDDISKNQNEKKYRVELKNNKIILLDNVEDEKLKQKIENFKFFSQYADFKDLKNY
    NCTC8325        FVNKVYDDISKNHNEKKYRVELKNNKIVLLDNVEDKKLKQKIENFKFFSQYADFKDLKNY
    Newman          FVNKVYDDISKNHNEKKYRVELKNNKIVLLDNVEDKKLKQKIENFKFFSQYADFKDLKNY
    USA300_FPR3757  FVNKVYDDISKNHNEKKYRVELKNNKIVLLDNVEDKKLKQKIENFKFFSQYADFKDLKNY
                    ****:*******:**************:*******:************************

    COL             QDGNITTNENVPSYEAQYKMNNSDKNVKKLREIYPITTNNSPNLKLYIDGDIKGSSVGYK
    N315            QDGSITTNENVPRYEAEYKLNNSDTNVKKLRDIYPITTKKAPILKLHIDGDIKGSSVGYK
    NCTC8325        QDGNITTNENVPSYEAQYKMNNSDKNVKKLREIYPITTNNSPNLKLYIDGDIKGSSVGYK
    Newman          QDGNITTNENVPSYEAQYKMNNSDKNVKKLREIYPITTNNSPNLKLYIDGDIKGSSVGYK
    USA300_FPR3757  QDGNITTNENVPSYEAQYKMNNSDKNVKKLREIYPITTNNSPNLKLYIDGDIKGSSVGYK
                    ***.******** ***:**:****.******:******:::* ***:*************

    COL             KIEYKFSKDKGQETTLRDYLNFGPSEGENVE
    N315            KIEYKFSKVKDQETTLRDYLNFGPSDEDS--
    NCTC8325        KIEYKFSKDKGQETTLRDYLNFGPSEGENVE
    Newman          KIEYKFSKDKGQETTLRDYLNFGPSEGENVE
    USA300_FPR3757  KIEYKFSKDKGQETTLRDYLNFGPSEGENVE
                    ******** *.**************: :.