From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0486 [new locus tag: SACOL_RS02460 ]
  • pan locus tag?: SAUPAN002135000
  • symbol: SACOL0486
  • pan gene symbol?: lpl9
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0486 [new locus tag: SACOL_RS02460 ]
  • symbol: SACOL0486
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 487593..488408
  • length: 816
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGATGGAGTATATAAAAAAAATTGCTTTGTACATGAGTGTATTACTTTTAATCATTTTT
    ATTGGGGGATGTGGAAATATGAAAGATGAACAGAAAAAAGAGGAACAAACGAATAAAACA
    GATTCAAAAGAAGAACAAATCAAAAAGAGTTTTGCGAAAACGTTAGATATGTATCCAATT
    AAGAATCTCGAGGATTTATACGACAAAGAAGGATATCGAGATGGTGAGTTTAAAAAAGGC
    GATAAAGGTACGTGGACTATACTTACAGGTTTTTCAAAAAGTAACAAACCAGGAGTATTA
    GATGATGAAGGCATGGTGTTATATCTTAATAGAAATACCAAAAAGGCAACAGGTTATTAT
    TTTGTAAATAAAGTTTATGATGATATTAGCAAAAATCATAATGAGAAAAAATATCGTGTT
    GAACTAAAAAATAATAAGATTGTTCTTTTGGATAATGTAGAAGACAAAAAACTTAAACAA
    AAAATTGAAAATTTTAAATTTTTTAGTCAGTATGCTGATTTTAAAGATTTAAAAAATTAT
    CAAGATGGAAATATAACAACTAATGAAAACGTACCGAGCTATGAAGCACAATATAAAATG
    AACAATAGTGATAAAAATGTAAAAAAACTTAGAGAAATTTATCCAATTACAACTAATAAC
    TCTCCAAATCTAAAATTATATATAGATGGTGATATAAAAGGAAGCTCAGTAGGATATAAA
    AAAATAGAATATAAATTTTCAAAAGATAAAGGTCAAGAGACAACATTAAGAGATTATTTG
    AATTTTGGACCGTCTGAAGGTGAGAATGTTGAGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    816

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0486 [new locus tag: SACOL_RS02460 ]
  • symbol: SACOL0486
  • description: hypothetical protein
  • length: 271
  • theoretical pI: 9.22493
  • theoretical MW: 31598.6
  • GRAVY: -0.961255

Function[edit source | edit]

  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 354.6)
  • TheSEED:  
    Tandem lipoprotein within Pathogenicity island 
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 383.1)
    and 2 more
    no clan definedFidL_like; FidL-like putative membrane protein (PF15941; HMM-score: 11.1)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 6.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: IFIGGCG
  • SignalP: no predicted signal peptide
    • Ymax: 0.423
    • Ymax_pos: 33
    • Cmax: 0.284
    • Cmax_pos: 33
    • Smax: 0.749
    • Smax_pos: 27
    • Smean: 0.477
    • D: 0.444
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MMEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWTILTGFSKSNKPGVLDDEGMVLYLNRNTKKATGYYFVNKVYDDISKNHNEKKYRVELKNNKIVLLDNVEDKKLKQKIENFKFFSQYADFKDLKNYQDGNITTNENVPSYEAQYKMNNSDKNVKKLREIYPITTNNSPNLKLYIDGDIKGSSVGYKKIEYKFSKDKGQETTLRDYLNFGPSEGENVE

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: 17.77 h [5]

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol. Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]