From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02460 [old locus tag: SACOL0486 ]
  • pan locus tag?: SAUPAN002135000
  • symbol: SACOL_RS02460
  • pan gene symbol?: lpl9
  • synonym:
  • product: tandem-type lipoprotein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS02460 [old locus tag: SACOL0486 ]
  • symbol: SACOL_RS02460
  • product: tandem-type lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 487596..488408
  • length: 813
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (487596..488408) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGGAGTATATAAAAAAAATTGCTTTGTACATGAGTGTATTACTTTTAATCATTTTTATT
    GGGGGATGTGGAAATATGAAAGATGAACAGAAAAAAGAGGAACAAACGAATAAAACAGAT
    TCAAAAGAAGAACAAATCAAAAAGAGTTTTGCGAAAACGTTAGATATGTATCCAATTAAG
    AATCTCGAGGATTTATACGACAAAGAAGGATATCGAGATGGTGAGTTTAAAAAAGGCGAT
    AAAGGTACGTGGACTATACTTACAGGTTTTTCAAAAAGTAACAAACCAGGAGTATTAGAT
    GATGAAGGCATGGTGTTATATCTTAATAGAAATACCAAAAAGGCAACAGGTTATTATTTT
    GTAAATAAAGTTTATGATGATATTAGCAAAAATCATAATGAGAAAAAATATCGTGTTGAA
    CTAAAAAATAATAAGATTGTTCTTTTGGATAATGTAGAAGACAAAAAACTTAAACAAAAA
    ATTGAAAATTTTAAATTTTTTAGTCAGTATGCTGATTTTAAAGATTTAAAAAATTATCAA
    GATGGAAATATAACAACTAATGAAAACGTACCGAGCTATGAAGCACAATATAAAATGAAC
    AATAGTGATAAAAATGTAAAAAAACTTAGAGAAATTTATCCAATTACAACTAATAACTCT
    CCAAATCTAAAATTATATATAGATGGTGATATAAAAGGAAGCTCAGTAGGATATAAAAAA
    ATAGAATATAAATTTTCAAAAGATAAAGGTCAAGAGACAACATTAAGAGATTATTTGAAT
    TTTGGACCGTCTGAAGGTGAGAATGTTGAGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    813

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS02460 [old locus tag: SACOL0486 ]
  • symbol: SACOL_RS02460
  • description: tandem-type lipoprotein
  • length: 270
  • theoretical pI: 9.22493
  • theoretical MW: 31467.4
  • GRAVY: -0.971852

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 354.6)
  • TheSEED:
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 383.1)
    no clan definedFidL_like; FidL-like putative membrane protein (PF15941; HMM-score: 11.1)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.429
    • Ymax_pos: 32
    • Cmax: 0.288
    • Cmax_pos: 32
    • Smax: 0.756
    • Smax_pos: 26
    • Smean: 0.46
    • D: 0.441
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 487720908 NCBI
  • RefSeq: WP_001805140 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKTDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWTILTGFSKSNKPGVLDDEGMVLYLNRNTKKATGYYFVNKVYDDISKNHNEKKYRVELKNNKIVLLDNVEDKKLKQKIENFKFFSQYADFKDLKNYQDGNITTNENVPSYEAQYKMNNSDKNVKKLREIYPITTNNSPNLKLYIDGDIKGSSVGYKKIEYKFSKDKGQETTLRDYLNFGPSEGENVE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS02460 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]