From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002163000
  • symbol?: mpsA
  • description?: NADH dehydrogenase subunit 5

      descriptions from strain specific annotations:

    • NADH dehydrogenase subunit 5
    • NADH dehydrogenase, subunit 5
    • NADH-Ubiquinone/plastoquinone (complex I), various chains family protein
    • putative NADH-Ubiquinone/plastoquinone (complexI) protein
    • NADH-quinone oxidoreductase subunit F
    • probable NADH-quinone oxidoreductase subunit 5 (nadhdehydrogenase subunit 5)
    • NADH-quinone oxidoreductase subunit L
    • NADH Ubiquinone plastoquinone protein
  • strand?: +
  • coordinates?: 2667986..2669470
  • synteny block?: BlockID0014640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0494 (nuoF)
    N315:
    SA0411 (ndhF)
    NCTC8325:
    Newman:
    NWMN_0418 (ndhF)
    USA300_FPR3757:
    04-02981:
    SA2981_0428 (ndhF)
    08BA02176:
    C248_0502
    11819-97:
    MS7_0425
    71193:
    ST398NM01_0518
    ECT-R 2:
    ECTR2_386
    ED133:
    SAOV_0469
    ED98:
    SAAV_0395 (nuoF)
    HO 5096 0412:
    SAEMRSA15_03770
    JH1:
    SaurJH1_0487
    JH9:
    SaurJH9_0474
    JKD6008:
    SAA6008_00455 (ndhF)
    JKD6159:
    SAA6159_00403 (ndhF)
    LGA251:
    SARLGA251_03860
    M013:
    M013TW_0414
    MRSA252:
    SAR0452
    MSHR1132:
    SAMSHR1132_03970
    MSSA476:
    SAS0410
    Mu3:
    SAHV_0450 (ndhF)
    Mu50:
    SAV0452 (ndhF)
    MW2:
    MW0407 (ndhF)
    RF122:
    SAB0402
    ST398:
    SAPIG0518
    T0131:
    SAT0131_00490
    TCH60:
    HMPREF0772_10070 (nuoF)
    TW20:
    SATW20_05210
    USA300_TCH1516:
    USA300HOU_0457
    VC40:
    SAVC_01850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSFQLLFSLFVIALIIALISGLLFLAPVMPMRYIKLHLYILVMPVLFAVIGFFGIHGQH
    N315            MLSFQLLFSLFVIALIIALISGLLFLAPVMPMRYIKLHLYILVMPVLFAVIGFFGIHGQH
    NCTC8325        MLSFQLLFSLFVIALIIALISGLLFLAPVMPMRYIKLHLYILVMPVLFAVIGFFGIHGQH
    Newman          MLSFQLLFSLFVIALIIALISGLLFLAPVMPMRYIKLHLYILVMPVLFAVIGFFGIHGQH
    USA300_FPR3757  MLSFQLLFSLFVIALIIALISGLLFLAPVMPMRYIKLHLYILVMPVLFAVIGFFGIHGQH
                    ************************************************************

    COL             VLGPFKIDRLSWLLAGFVMALGFIIQKFSMRYLLGDHHYRHYFPLFTAITSFASLAWMSE
    N315            VLGPFKIDRLSWLLAGFVMALGFIIQKFSMRYLLGDHHYRHYFPLFTAITSFASLAWMSE
    NCTC8325        VLGPFKIDRLSWLLAGFVMALGFIIQKFSMRYLLGDHHYRHYFPLFTAITSFASLAWMSE
    Newman          VLGPFKIDRLSWLLAGFVMALGFIIQKFSMRYLLGDHHYRHYFPLFTAITSFASLAWMSE
    USA300_FPR3757  VLGPFKIDRLSWLLAGFVMALGFIIQKFSMRYLLGDHHYRHYFPLFTAITSFASLAWMSE
                    ************************************************************

    COL             DLRLMALCWGITLLCLTLLMNVNRFWKVPRESAKLSSMTFLCGWLAFVGAIVTIYIATGE
    N315            DLRLMALCWGMTLLCLTLLMNVNRFWKVPRESAKLSSMTFLCGWLAFVGAIVTIYIATGE
    NCTC8325        DLRLMALCWGITLLCLTLLMNVNRFWKVPRESAKLSSMTFLCGWLAFVGAIVTIYIATGE
    Newman          DLRLMALCWGITLLCLTLLMNVNRFWKVPRESAKLSSMTFLCGWLAFVGAIVTIYIATGE
    USA300_FPR3757  DLRLMALCWGITLLCLTLLMNVNRFWKVPRESAKLSSMTFLCGWLAFVGAIVTIYIATGE
                    **********:*************************************************

    COL             WRVPQHIVHPTWSLLTNVLLVLAVMIPAAQFPFHRWLIESVTAPTPVSAIMHAGIVNAGG
    N315            WRVPQHIVHPTWSLLTNVLLVLAVMIPAAQFPFHRWLIESVTAPTPVSAIMHAGIVNAGG
    NCTC8325        WRVPQHIVHPTWSLLTNVLLVLAVMIPAAQFPFHRWLIESVTAPTPVSAIMHAGIVNAGG
    Newman          WRVPQHIVHPTWSLLTNVLLVLAVMIPAAQFPFHRWLIESVTAPTPVSAIMHAGIVNAGG
    USA300_FPR3757  WRVPQHIVHPTWSLLTNVLLVLAVMIPAAQFPFHRWLIESVTAPTPVSAIMHAGIVNAGG
                    ************************************************************

    COL             VILTRFAPIFDNGFALSLLLILSSISVLLGSGISLVQVDYKRQLVGSTMSQMGFMLVQCA
    N315            VILTRFAPIFDNGFALSLLLILSSISVLLGSGISLVQVDYKRQLVGSTMSQMGFMLVQCA
    NCTC8325        VILTRFAPIFDNGFALSLLLILSSISVLLGSGISLVQVDYKRQLVGSTMSQMGFMLVQCA
    Newman          VILTRFAPIFDNGFALSLLLILSSISVLLGSGISLVQVDYKRQLVGSTMSQMGFMLVQCA
    USA300_FPR3757  VILTRFAPIFDNGFALSLLLILSSISVLLGSGISLVQVDYKRQLVGSTMSQMGFMLVQCA
                    ************************************************************

    COL             LGVYSAAIIHLILHGIFKATLFLQSGSIVKRFNIPKQASAKDAYGWIVMGRVLAIIVAFL
    N315            LGVYSAAIIHLILHGIFKATLFLQSGSIVKRFNIPKQASAKDAYGWIVMGRVLAIIVAFL
    NCTC8325        LGVYSAAIIHLILHGIFKATLFLQSGSIVKRFNIPKQASAKDAYGWIVMGRVLAIIVAFL
    Newman          LGVYSAAIIHLILHGIFKATLFLQSGSIVKRFNIPKQASAKDAYGWIVMGRVLAIIVAFL
    USA300_FPR3757  LGVYSAAIIHLILHGIFKATLFLQSGSIVKRFNIPKQASAKDAYGWIVMGRVLAIIVAFL
                    ************************************************************

    COL             FWMSSDRSAYEVLSALILGWSLLVSWNQMVAFSKGRMARLVGMILIAIVTFIYVITHNYF
    N315            FWMSSDRSAYEVLSALILAWSLLVSWNQMVAFSKGRMARLVGMILIAIVTFIYVITHNYF
    NCTC8325        FWMSSDRSAYEVLSALILGWSLLVSWNQMVAFSKGRMARLVGMILIAIVTFIYVITHNYF
    Newman          FWMSSDRSAYEVLSALILGWSLLVSWNQMVAFSKGRMARLVGMILIAIVTFIYVITHNYF
    USA300_FPR3757  FWMSSDRSAYEVLSALILGWSLLVSWNQMVAFSKGRMARLVGMILIAIVTFIYVITHNYF
                    ******************.*****************************************

    COL             YAVLQNITTHATTPPTVSVIISVVILIFGSLLSIWVARHRYSKAFEVLYVWLVNLGEARS
    N315            YDVLQNITTHATTPPTVSVIISVVILIFGSLLSIWVARHRYSKGFAVLYVWLVNLGEARS
    NCTC8325        YAVLQNITTHATTPPTVSVIISVVILIFGSLLSIWVARHRYSKAFAVLYVWLVNLGEARS
    Newman          YAVLQNITTHATTPPTVSVIISVVILIFGSLLSIWVARHRYSKAFAVLYVWLVNLGEARS
    USA300_FPR3757  YAVLQNITTHATTPPTVSVIISVVILIFGSLLSIWVARHRYSKAFAVLYVWLVNLGEARS
                    * *****************************************.* **************

    COL             KAIESHPNYLKKYL
    N315            KAIESHPNYLKKYL
    NCTC8325        KAIESHPNYLKKYL
    Newman          KAIESHPNYLKKYL
    USA300_FPR3757  KAIESHPNYLKKYL
                    **************