From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002164000
  • symbol?: mpsB
  • description?: putative transmembrane protein coupled to NADH-ubiquinone oxidoreductase chain 5

      descriptions from strain specific annotations:

    • putative transmembrane protein coupled to NADH-ubiquinone oxidoreductase chain 5
    • transmembrane protein coupled to NADH-ubiquinone oxidoreductase chain 5
  • strand?: +
  • coordinates?: 2669474..2672195
  • synteny block?: BlockID0014650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0429
    08BA02176:
    C248_0503
    11819-97:
    MS7_0426
    71193:
    ST398NM01_0519
    ECT-R 2:
    ECTR2_387
    ED133:
    SAOV_0470
    ED98:
    SAAV_0396
    HO 5096 0412:
    SAEMRSA15_03780
    JH1:
    SaurJH1_0488
    JH9:
    SaurJH9_0475
    JKD6008:
    SAA6008_00456
    JKD6159:
    SAA6159_00404
    LGA251:
    SARLGA251_03870
    M013:
    M013TW_0417
    MRSA252:
    SAR0453
    MSHR1132:
    SAMSHR1132_03980
    MSSA476:
    SAS0411
    Mu3:
    SAHV_0451
    Mu50:
    SAV0453
    MW2:
    MW0408
    RF122:
    SAB0403
    ST398:
    SAPIG0519
    T0131:
    SAT0131_00491
    TCH60:
    HMPREF0772_10069
    TW20:
    SATW20_05220
    USA300_TCH1516:
    USA300HOU_0458
    VC40:
    SAVC_01855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTQLNINSVIENAKRVITPLSPISIFAARNPWEGLEADTFEDVAKWLRDVRDVDIFPNK
    N315            MTTQLNINSVIENAKRVITPLSPISIFAARNPWEGLEADTFEDVAKWLRDVRDVDIFPNK
    NCTC8325        MTTQLNINSVIENAKRVITPLSPISIFAARNPWEGLEADTFEDVAKWLRDVRDVDIFPNK
    Newman          MTTQLNINSVIENAKRVITPLSPISIFAARNPWEGLEADTFEDVAKWLRDVRDVDIFPNK
    USA300_FPR3757  MTTQLNINSVIENAKRVITPLSPISIFAARNPWEGLEADTFEDVAKWLRDVRDVDIFPNK
                    ************************************************************

    COL             ALIESAVARGELDESVFNQLVTDMLLEHHYNIPQHYINLYIDNIKTLKDVPASYMNHSNV
    N315            ALIESAVARGELDESVFNQLVTDMLLEHHYNIPQHYINLYIDNIKTLKDVPASYMNHSNV
    NCTC8325        ALIESAVARGELDESVFNQLVTDMLLEHHYNIPQHYINLYIDNIKTLKDVPASYMNHSNV
    Newman          ALIESAVARGELDESVFNQLVTDMLLEHHYNIPQHYINLYIDNIKTLKDVPASYMNHSNV
    USA300_FPR3757  ALIESAVARGELDESVFNQLVTDMLLEHHYNIPQHYINLYIDNIKTLKDVPASYMNHSNV
                    ************************************************************

    COL             DVVADLLLEKSKRDMAESYHHYDVRPMSDAIIDEQGEPLSEQVNRQMIKWTKLYIDQFLS
    N315            DVVADLLLEKSKRDMAESYHHYDVRPMSDAIIDEQGEPLSEQVNRQMIKWTKLYIDQFLS
    NCTC8325        DVVADLLLEKSKRDMAESYHHYDVRPMSDAIIDEQGEPLSEQVNRQMIKWTKLYIDQFLS
    Newman          DVVADLLLEKSKRDMAESYHHYDVRPMSDAIIDEQGEPLSEQVNRQMIKWTKLYIDQFLS
    USA300_FPR3757  DVVADLLLEKSKRDMAESYHHYDVRPMSDAIIDEQGEPLSEQVNRQMIKWTKLYIDQFLS
                    ************************************************************

    COL             SWTMPKREQSFYHAWLHLAQHDHSFTKAQRQVIKGLPNDPEMTIESVLTHFSIDQEDYQA
    N315            SWTMPKREQSFYHAWLHLAQHDHSFTKAQRQVIKGLPNDPEMTIESVLTYFSIDQEDYQA
    NCTC8325        SWTMPKREQSFYHAWLHLAQHDHSFTKAQRQVIKGLPNDPEMTIESVLTHFSIDQEDYQA
    Newman          SWTMPKREQSFYHAWLHLAQHDHSFTKAQRQVIKGLPNDPEMTIESVLTHFSIDQEDYQA
    USA300_FPR3757  SWTMPKREQSFYHAWLHLAQHDHSFTKAQRQVIKGLPNDPEMTIESVLTHFSIDQEDYQA
                    *************************************************:**********

    COL             YVEGHLLALPGWAGMLYYRSQQHHFEQHLLTDYLAIRLVVEQLLVGDEFKSVAKDCESRS
    N315            YVEGHLLALPGWAGMLYYRSQQHHFEQHLLTDYLAIRLVVEQLLVGDEFKSVTKDCESRS
    NCTC8325        YVEGHLLALPGWAGMLYYRSQQHHFEQHLLTDYLAIRLVVEQLLVGDEFKSVAKDCESRS
    Newman          YVEGHLLALPGWAGMLYYRSQQHHFEQHLLTDYLAIRLVVEQLLVGDEFKSVAKDCESRS
    USA300_FPR3757  YVEGHLLALPGWAGMLYYRSQQHYFEQHLLTDYLAIRLVVEQLLVGDEFKSVAKDCESRS
                    ***********************:****************************:*******

    COL             ENWFKQTVASWCYYSDMPSDVLLQHDVNEIQTFIHFAATMNKNVFKNLWLIAWEMTYESQ
    N315            ENWFKQTVASLCYYSDMPSDVLLQHDVNEIQTFIHFAATMNKNVFKNLWLIAWEMTYESQ
    NCTC8325        ENWFKQTVASWCYYSDMPSDVLLQHDVNEIQTFIHFAATMNKNVFKNLWLIAWEMTYESQ
    Newman          ENWFKQTVASWCYYSDMPSDVLLQHDVNEIQTFIHFAATMNKNVFKNLWLIAWEMTYESQ
    USA300_FPR3757  ENWFKQTVASWCYYSDMPSDVLLQHDVNEIQTFIHFAATMNKNVFKNLWLIAWEMTYESQ
                    ********** *************************************************

    COL             LKQKIKAGHESVAGALDVNQVNVSENDNANQPHSVLLNDTQAVDENNSELNQMGTSTKAQ
    N315            LKQKIKAGHESVAGALDVNQVNVSENDNANQPHSVLLNDTQAVDENNSELNQVGTSTKAQ
    NCTC8325        LKQKIKAGHESVAGALDVNQVNVSENDNANQPHSVLLNDTQAVDENNSELNQMGTSTKAQ
    Newman          LKQKIKAGHESVAGALDVNQVNVSENDNANQPHSVLLNDTQAVDENNSELNQMGTSTKAQ
    USA300_FPR3757  LKQKIKAGHESVAGALDVNQVNVSENDNANQPHSVLLNDTQAVDENNSELNQMGTSTKAQ
                    ****************************************************:*******

    COL             IAFCIDVRSEPFRRHIEAAGPFETIGIAGFFGLPIQKDAVDEQFKHDSLPVMVPPAYRIK
    N315            IAFCIDVRSEPFRRHIEAAGPFETIGIAGFFGLPIQKDAVDEQFKHDSLPVMVPPAYRIK
    NCTC8325        IAFCIDVRSEPFRRHIEAAGPFETIGIAGFFGLPIQKDAVDEQFKHDSLPVMVPPAYRIK
    Newman          IAFCIDVRSEPFRRHIEAAGPFETIGIAGFFGLPIQKDAVDEQFKHDSLPVMVPPAYRIK
    USA300_FPR3757  IAFCIDVRSEPFRRHIEAAGPFETIGIAGFFGLPIQKDAVDEQFKHDSLPVMVPPAYRIK
                    ************************************************************

    COL             EFADRYDMNVYRQQQQTMSSMFYTFKLMKNNVMPSLLLPELSGPFLSLSTIVNSIMPRKS
    N315            EFADRYDMNVYRQQQQTMSSMFYTFKLMKNNVMPSLLLPELSGPFLSLSTIVNSIMPRKS
    NCTC8325        EFADRYDMNVYRQQQQTMSSMFYTFKLMKNNVMPSLLLPELSGPFLSLSTIVNSIMPRKS
    Newman          EFADRYDMNVYRQQQQTMSSMFYTFKLMKNNVMPSLLLPELSGPFLSLSTIVNSIMPRKS
    USA300_FPR3757  EFADRYDMNVYRQQQQTMSSMFYTFKLMKNNVMPSLLLPELSGPFLSLSTIVNSIMPRKS
                    ************************************************************

    COL             RASLQKIKQKWLKKPETKLTIDREFDRTSDLPVGFTEQEQIDFALQALKLMDLTEAFAPF
    N315            RASLQKIKQKWLKKPETKLTIDREFDRTSDLPVGFTEQEQIDFALQALKLMDLTEAFAPF
    NCTC8325        RASLQKIKQKWLKKPETKLTIDREFDRTSDLPVGFTEQEQIDFALQALKLMDLTEAFAPF
    Newman          RASLQKIKQKWLKKPETKLTIDREFDRTSDLPVGFTEQEQIDFALQALKLMDLTEAFAPF
    USA300_FPR3757  RASLQKIKQKWLKKPETKLTIDREFDRTSDLPVGFTEQEQIDFALQALKLMDLTEAFAPF
                    ************************************************************

    COL             VVLAGHASHSHNNPHHASLECGACGGASSGFNAKLLAMICNRPNVRQGLKQSGVYIPETT
    N315            VVLAGHASHSHNNPHHASLECGACGGASSGFNAKLLAMICNRPNVRQGLKQSGVYIPETT
    NCTC8325        VVLAGHASHSHNNPHHASLECGACGGASSGFNAKLLAMICNRPNVRQGLKQSGVYIPETT
    Newman          VVLAGHASHSHNNPHHASLECGACGGASSGFNAKLLAMICNRPNVRQGLKQSGVYIPETT
    USA300_FPR3757  VVLAGHASHSHNNPHHASLECGACGGASSGFNAKLLAMICNRPNVRQGLKQSGVYIPETT
                    ************************************************************

    COL             VFAVAEHHTSTDTLAWVYVPDTLSSIALDAYESLNDAMPMISEHANRERLDKLPTIGRVN
    N315            VFAAAEHHTSTDTLAWVYVPDTLSALALDAYESLNDAMPMISEQANRERLDKLPTIGRVN
    NCTC8325        VFAVAEHHTSTDTLAWVYVPDTLSSIALDAYESLNDAMPMISEHANRERLDKLPTIGRVN
    Newman          VFAVAEHHTSTDTLAWVYVPDTLSSIALDAYESLNDAMPMISEHANRERLDKLPTIGRVN
    USA300_FPR3757  VFAVAEHHTSTDTLAWVYVPDTLSSIALDAYESLNDAMPMISEHANRERLDKLPTIGRVN
                    ***.********************::*****************:****************

    COL             HPVEEAQRFASDWSEVRPEWGLAKNASFIIGRRQLTKGIDLEGRTFLHNYDWRKDKDGTL
    N315            HPVEEAQRFASDWSEVRPEWGLAKNASFIIGRRQLTKGIDLEGRTFLHNYDWRKDKDGKL
    NCTC8325        HPVEEAQRFASDWSEVRPEWGLAKNASFIIGRRQLTKGIDLEGRTFLHNYDWRKDKDGTL
    Newman          HPVEEAQRFASDWSEVRPEWGLAKNASFIIGRRQLTKGIDLEGRTFLHNYDWRKDKDGTL
    USA300_FPR3757  HPVEEAQRFASDWSEVRPEWGLAKNASFIIGRRQLTKGIDLEGRTFLHNYDWRKDKDGTL
                    **********************************************************.*

    COL             LNTIISGPALVAQWINLQYYASTVAPHFYGSGNKATQTVTSGVGVMQGNASDLMYGLSWQ
    N315            LNTIISGPALVAQWINLQYYASTVAPHFYGSGNKATQTVTSGVGVMQGNASDLMYGLSWQ
    NCTC8325        LNTIISGPALVAQWINLQYYASTVAPHFYGSGNKATQTVTSGVGVMQGNASDLMYGLSWQ
    Newman          LNTIISGPALVAQWINLQYYASTVAPHFYGSGNKATQTVTSGVGVMQGNASDLMYGLSWQ
    USA300_FPR3757  LNTIISGPALVAQWINLQYYASTVAPHFYGSGNKATQTVTSGVGVMQGNASDLMYGLSWQ
                    ************************************************************

    COL             SVMAADRTMYHSPIRLLVVIQAPDYVVARLLANNEHFARKVSNHWLRLMSVNEEGRFKSW
    N315            SVMAADRTMYHSPIRLLVVIQAPDYVVARLFANNEHFARKVSNHWLRLMSVNEEGRFKSW
    NCTC8325        SVMAADRTMYHSPIRLLVVIQAPDYVVARLLANNEHFARKVSNHWLRLMSVNEEGRFKSW
    Newman          SVMAADRTMYHSPIRLLVVIQAPDYVVARLLANNEHFARKVSNHWLRLMSVNEEGRFKSW
    USA300_FPR3757  SVMAADRTMYHSPIRLLVVIQAPDYVVARLLANNEHFARKVSNHWLRLMSVNEEGRFKSW
                    ******************************:*****************************

    COL             I
    N315            I
    NCTC8325        I
    Newman          I
    USA300_FPR3757  I
                    *