Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002176000
  • symbol?: metN2
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • Methionine ABC transporter ATP-binding protein
    • methionine import ATP-binding protein metN
    • DL-methionine transporter ATP-binding subunit
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • pseudogene
    • Methionine import ATP-binding protein MetN 1
  • strand?: +
  • coordinates?: 2680429..2681458
  • synteny block?: BlockID0014770
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0437
    08BA02176:
    C248_0511
    11819-97:
    MS7_0435 (metN)
    71193:
    ST398NM01_0527
    ECT-R 2:
    ECTR2_395
    ED133:
    SAOV_0479
    ED98:
    SAAV_0404
    HO 5096 0412:
    SAEMRSA15_03870
    JH1:
    SaurJH1_0496
    JH9:
    SaurJH9_0483
    JKD6008:
    SAA6008_00465 (metN)
    JKD6159:
    SAA6159_00411 (metN)
    LGA251:
    SARLGA251_03950
    M013:
    M013TW_0426
    MRSA252:
    SAR0461
    MSHR1132:
    SAMSHR1132_04060
    MSSA476:
    SAS0419
    Mu3:
    SAHV_0459
    Mu50:
    SAV0462
    MW2:
    MW0416
    RF122:
    SAB0411
    ST398:
    SAPIG0527
    T0131:
    SAT0131_00501
    TCH60:
    HMPREF0772_10061 (metN)
    TW20:
    SATW20_05300
    USA300_TCH1516:
    VC40:
    SAVC_01895

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG
    N315            MIEFRQVSKSFHKKKQTIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG
    NCTC8325        MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG
    Newman          ----------------------------------------------MVRLVNHLEAASNG
    USA300_FPR3757  MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNG
                                                                  :*************

    COL             QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILSKKSKTEIKQR
    N315            QVIVDGHDITNYSEKGMREIKKDIGMIFQHFNLLNSATVFKNVAMPLILSKKSKTEIKQR
    NCTC8325        QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILSKKSKTEIKQR
    Newman          QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILSKKSKTEIKQR
    USA300_FPR3757  QVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVAMPLILSKKSKTEIKQR
                    *************:* **:*****************************************

    COL             VTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCDEATSALDPATTASIL
    N315            VTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCDEATSALDPATTASIL
    NCTC8325        VTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCDEATSALDPATTASIL
    Newman          VTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCDEATSALDPATTASIL
    USA300_FPR3757  VTEMLEFVGLSDKKDQFPDELSGGQKQRVAIARALVTNPKILLCDEATSALDPATTASIL
                    ************************************************************

    COL             TLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTVKEVFSHPKTTIAQNF
    N315            TLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVETGTVKEVFSHPKTTIAQNF
    NCTC8325        TLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTVKEVFSHPKTTIAQNF
    Newman          TLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTVKEVFSHPKTTIAQNF
    USA300_FPR3757  TLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGKVVETGTVKEVFSHPKTTIAQNF
                    *************************************:**********************

    COL             VSTVIQTEPSTSLIRRLNDEQVGDFKDYKIFVEETQVTQPIINDLIQICGREVKILFSSM
    N315            VSTVIQTEPSTSLIRRLNDEQVGGFKDYKIFVEETQVTQPIINDLIQICGREVKILFSSM
    NCTC8325        VSTVIQTEPSTSLIRRLNDEQVGDFKDYKIFVEETQVTQPIINDLIQICGREVKILFSSM
    Newman          VSTVIQTEPSTSLIRRLNDEQVGDFKDYKIFVEETQVTQPIINDLIQICGREVKILFSSM
    USA300_FPR3757  VSTVIQTEPSTSLIRRLNDEQVGDFKDYKIFVEETQVTQPIINDLIQICGREVKILFSSM
                    ***********************.************************************

    COL             SEIQGNTVCYMWLRFNMDQQFEDTAINQYFKEKNIQFEEVH
    N315            SEIQGNTVCYMWLRFNIDQQFDDTAINQYFKEKNIQFEEVH
    NCTC8325        SEIQGNTVCYMWLRFNMDQQFEDTAINQYFKEKNIQFEEVH
    Newman          SEIQGNTVCYMWLRFNMDQQFEDTAINQYFKEKNIQFEEVH
    USA300_FPR3757  SEIQGNTVCYMWLRFNMDQQFEDTAINQYFKEKNIQFEEVH
                    ****************:****:*******************