From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002181000
  • symbol?:
  • description?: NUDIX hydrolase

      descriptions from strain specific annotations:

    • NUDIX hydrolase
    • NUDIX domain-containing protein
    • MutT/nudix family protein
    • MutT domain containing protein
    • NADH pyrophosphatase
    • phosphohydrolase
    • MutT/NUDIX family protein, putative
  • strand?: +
  • coordinates?: 2685160..2685570
  • synteny block?: BlockID0014820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0442
    08BA02176:
    C248_0516
    11819-97:
    MS7_0440
    71193:
    ST398NM01_0532
    ECT-R 2:
    ECTR2_400
    ED133:
    SAOV_0484
    ED98:
    SAAV_0409
    HO 5096 0412:
    SAEMRSA15_03920
    JH1:
    SaurJH1_0501
    JH9:
    SaurJH9_0488
    JKD6008:
    SAA6008_00470
    JKD6159:
    SAA6159_00416
    LGA251:
    SARLGA251_04000
    M013:
    M013TW_0431
    MRSA252:
    SAR0466
    MSHR1132:
    SAMSHR1132_04110
    MSSA476:
    SAS0424
    Mu3:
    SAHV_0464
    Mu50:
    SAV0467
    MW2:
    MW0421
    RF122:
    SAB0416
    ST398:
    SAPIG0532
    T0131:
    SAT0131_00507
    TCH60:
    HMPREF0772_10056
    TW20:
    SATW20_05350
    USA300_TCH1516:
    USA300HOU_0467
    VC40:
    SAVC_01920

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MIKCVCLVEETADKILLVQVRNREKYYFPGGKIEEGESQVHALLREVKEELNLTLTM
    N315            ---MIKCVCLVEETADKILLVQVRNREKYYFPGGKIEEGESQVHALLREVKEELNLTLTM
    NCTC8325        ---MIKCVCLVEETADKILLVQVRNREKYYFPGGKIEEGESQVHALLREVKEELNLTLTM
    Newman          MSKMIKCVCLVEETADKILLVQVRNREKYYFPGGKIEEGESQVHALLREVKEELNLTLTM
    USA300_FPR3757  ---MIKCVCLVEETADKILLVQVRNREKYYFPGGKIEEGESQVHALLREVKEELNLTLTM
                       *********************************************************

    COL             DEIEYVGTIVGPAYPQQDMLTELNGFRALTKIDWENVTINNEITDIRWIDKDNDALIAPA
    N315            DEIEYIGTIVGPAYPQQDMLTELNGFRALTKIDWENVTINNEITDIRWIDKDNDALIAPA
    NCTC8325        DEIEYVGTIVGPAYPQQDMLTELNGFRALTKIDWENVTINNEITDIRWIDKDNDALIAPA
    Newman          DEIEYVGTIVGPAYPQQDMLTELNGFRALTKIDWENVTINNEITDIRWIDKDNDALIAPA
    USA300_FPR3757  DEIEYVGTIVGPAYPQQDMLTELNGFRALTKIDWENVTINNEITDIRWIDKDNDALIAPA
                    *****:******************************************************

    COL             VKVWIETYGGKHDK
    N315            VKVWIETYGGKHDK
    NCTC8325        VKVWIETYGGKHDK
    Newman          VKVWIETYGGKHDK
    USA300_FPR3757  VKVWIETYGGKHDK
                    **************