From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002185000
  • symbol?: gltC
  • description?: transcription activator of glutamate synthase operon

      descriptions from strain specific annotations:

    • transcription activator of glutamate synthase operon
    • LysR family transcriptional regulator
    • transcriptional regulatory protein GltC
    • regulatory helix-turn-helix protein, lysR family protein
    • LysR family regulatory protein
    • glutamate synthase operon transcriptional regulator
    • transcriptional activator of glutamate synthase operon
    • bacterial regulatory helix-turn-helix , lysR family protein
    • gltC, transcription activator of glutamatesynthase operon
  • strand?: -
  • coordinates?: 2688256..2689140
  • synteny block?: BlockID0014860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0513 (gltC)
    N315:
    SA0429 (gltC)
    NCTC8325:
    Newman:
    NWMN_0435 (gltC)
    USA300_FPR3757:
    04-02981:
    SA2981_0446 (gltC)
    08BA02176:
    C248_0520
    11819-97:
    MS7_0444
    71193:
    ST398NM01_0536
    ECT-R 2:
    ECTR2_404
    ED133:
    SAOV_0488c
    ED98:
    SAAV_0413
    HO 5096 0412:
    SAEMRSA15_03960
    JH1:
    SaurJH1_0505
    JH9:
    SaurJH9_0492
    JKD6008:
    SAA6008_00474 (gltC)
    JKD6159:
    SAA6159_00420 (gltC)
    LGA251:
    SARLGA251_04040
    M013:
    M013TW_0435
    MRSA252:
    SAR0470
    MSHR1132:
    SAMSHR1132_04150
    MSSA476:
    SAS0428
    Mu3:
    SAHV_0468 (gltC)
    Mu50:
    SAV0471 (gltC)
    MW2:
    MW0425 (gltC)
    RF122:
    SAB0420c
    ST398:
    SAPIG0536
    T0131:
    SAT0131_00512 (glcA)
    TCH60:
    HMPREF0772_10052 (gltC)
    TW20:
    SATW20_05390
    USA300_TCH1516:
    USA300HOU_0471 (gltC)
    VC40:
    SAVC_01940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEIKQLRYFIEVAKREHISETALELNIAQSAISRQITLLEQELNVSLFKKQGRNITLTSE
    N315            MEIKQLRYFIEVAKREHISETALELNIAQSAISRQITLLEQELNVSLFKKQGRNITLTSE
    NCTC8325        MEIKQLRYFIEVAKREHISETALELNIAQSAISRQITLLEQELNVSLFKKQGRNITLTSE
    Newman          MEIKQLRYFIEVAKREHISETALELNIAQSAISRQITLLEQELNVSLFKKQGRNITLTSE
    USA300_FPR3757  MEIKQLRYFIEVAKREHISETALELNIAQSAISRQITLLEQELNVSLFKKQGRNITLTSE
                    ************************************************************

    COL             GKLLFNEALRIIEHLDSTIEQFQSHGLTKNKSIYIGYDESDVSHMLLPLIQTFHLQNDTH
    N315            GKLLFNEALRIIEHLDSTIEQFQSHGLTKNKSIYIGYDESDVSHMLLPLIQTFHLQNDTH
    NCTC8325        GKLLFNEALRIIEHLDSTIEQFQSHGLTKNKSIYIGYDESDVSHMLLPLIQTFHLQNDTH
    Newman          GKLLFNEALRIIEHLDSTIEQFQSHGLTKNKSIYIGYDESDVSHMLLPLIQTFHLQNDTH
    USA300_FPR3757  GKLLFNEALRIIEHLDSTIEQFQSHGLTKNKSIYIGYDESDVSHMLLPLIQTFHLQNDTH
                    ************************************************************

    COL             VIPSLLEHDTIINSVLNGNIDIGFTELTPEIRKHKQLNMLPLFEEHYHLYAPSDDPITMA
    N315            VIPSLLDHDTIINSVLNGNIDIGFTELTPEIRKHKQLHMLPLFEEHYHLYAPSDDPITMA
    NCTC8325        VIPSLLEHDTIINSVLNGNIDIGFTELTPEIRKHKQLHMLPLFEEHYHLYAPSDDPITMA
    Newman          VIPSLLEHDTIINSVLNGNIDIGFTELTPEIRKHKQLHMLPLFEEHYHLYAPSDDPITMA
    USA300_FPR3757  VIPSLLEHDTIINSVLNGNIDIGFTELTPEIRKHKQLHMLPLFEEHYHLYAPSDDPITMA
                    ******:******************************:**********************

    COL             THPPLIQFEHSHIYCLAPFAETVKKQLRKITKSDVYTISSQPLAQYLLRQKEGYIISSQN
    N315            THPPLIQFEHSHIYCLAPFAETVKKQLRKITKSDVYTISSQPLAQYLLRQKEGYIISSQN
    NCTC8325        THPPLIQFEHSHIYCLAPFAETVKKQLRKITKSDVYTISSQPLAQYLLRQKEGYIISSQN
    Newman          THPPLIQFEHSHIYCLAPFAETVKKQLRKITKSDVYTISSQPLAQYLLRQKEGYIISSQN
    USA300_FPR3757  THPPLIQFEHSHIYCLAPFAETVKKQLRKITKSDVYTISSQPLAQYLLRQKEGYIISSQN
                    ************************************************************

    COL             IHLPESKSWIDIKLDHTELKRTICAITKEPYTKSDIGILLTLIQQLMTKTSTFH
    N315            IHLPESKSWIDIKLDHTELKRTICAITKEPYTKSDIGILLTLIQQLMTKTSTFH
    NCTC8325        IHLPESKSWIDIKLDHTELKRTICAITKEPYTKSDIGILLTLIQQLMTKTSTFH
    Newman          IHLPESKSWIDIKLDHTELKRTICAITKEPYTKSDIGILLTLIQQLMTKTSTFH
    USA300_FPR3757  IHLPESKSWIDIKLDHTELKRTICAITKEPYTKSDIGILLTLIQQLMTKTSTFH
                    ******************************************************