From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002187000
  • symbol?: gltD
  • description?: glutamate synthase subunit beta

      descriptions from strain specific annotations:

    • glutamate synthase subunit beta
    • glutamate synthase
    • glutamate synthase, small subunit
    • glutamate synthase [NADPH] small chain (NADPH-GOGAT)
    • glutamate synthase (NADPH) small subunit
    • glutamate synthase, NADH/NADPH, small subunit domain protein
    • Glutamate synthase [NADPH] small chain
    • glutamate synthase beta subunit
    • glutamate synthase small chain
    • glutamate synthase small subunit
  • strand?: +
  • coordinates?: 2693839..2695302
  • synteny block?: BlockID0014880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0515 (gltD)
    N315:
    SA0431 (gltD)
    NCTC8325:
    Newman:
    NWMN_0437 (gltD)
    USA300_FPR3757:
    04-02981:
    SA2981_0448 (gltD)
    08BA02176:
    C248_0522 (gltB)
    11819-97:
    MS7_0446 (gltD)
    71193:
    ST398NM01_0538
    ECT-R 2:
    ECTR2_406 (gltD)
    ED133:
    SAOV_0490
    ED98:
    SAAV_0415 (gltD)
    HO 5096 0412:
    SAEMRSA15_03980 (gltB)
    JH1:
    SaurJH1_0507 (gltD)
    JH9:
    SaurJH9_0494 (gltD)
    JKD6008:
    SAA6008_00476 (gltD)
    JKD6159:
    SAA6159_00422 (gltD)
    LGA251:
    SARLGA251_04060 (gltB)
    M013:
    M013TW_0437
    MRSA252:
    SAR0472 (gltD)
    MSHR1132:
    SAMSHR1132_04170
    MSSA476:
    SAS0430 (gltD)
    Mu3:
    SAHV_0470 (gltD)
    Mu50:
    SAV0473 (gltD)
    MW2:
    MW0427 (gltD)
    RF122:
    SAB0422 (gltD)
    ST398:
    SAPIG0538
    T0131:
    SAT0131_00514
    TCH60:
    HMPREF0772_10050 (gltD)
    TW20:
    SATW20_05410 (gltB)
    USA300_TCH1516:
    USA300HOU_0473 (gltD)
    VC40:
    SAVC_01950 (gltD)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGEFKGFMKYDKQYLGELSLVDRLKHHKAYQQRFTKEDASIQGARCMDCGTPFCQTGQQY
    N315            MGEFKGFMKYDKQYLGELSLVDRLKHHKAYQQRFTKEDASIQGARCMDCGTPFCQTGQQY
    NCTC8325        MGEFKGFMKYDKQYLGELSLVDRLKHHKAYQQRFTKEDASIQGARCMDCGTPFCQTGQQY
    Newman          MGEFKGFMKYDKQYLGELSLVDRLKHHKAYQQRFTKEDASIQGARCMDCGTPFCQTGQQY
    USA300_FPR3757  MGEFKGFMKYDKQYLGELSLVDRLKHHKAYQQRFTKEDASIQGARCMDCGTPFCQTGQQY
                    ************************************************************

    COL             GRETIGCPIGNYIPEWNDLVYHQDFKTAYERLSETNNFPDFTGRVCPAPCESACVMKINR
    N315            GRETIGCPIGNYIPEWNDLVYHQDFKTAYERLSETNNFPDFTGRVCPAPCESACVMKINR
    NCTC8325        GRETIGCPIGNYIPEWNDLVYHQDFKTAYERLSETNNFPDFTGRVCPAPCESACVMKINR
    Newman          GRETIGCPIGNYIPEWNDLVYHQDFKTAYERLSETNNFPDFTGRVCPAPCESACVMKINR
    USA300_FPR3757  GRETIGCPIGNYIPEWNDLVYHQDFKTAYERLSETNNFPDFTGRVCPAPCESACVMKINR
                    ************************************************************

    COL             ESIAIKGIERTIIDEAFENGWVAPKVPSRRRDEKVAIVGSGPAGLAAAEELNLLGYQVTI
    N315            ESIAIKGIERTIIDEAFENGWVAPKVPSRRRDEKVAIVGSGPAGLTAAEELNLLGYQVTI
    NCTC8325        ESIAIKGIERTIIDEAFENGWVAPKVPSRRRDEKVAIVGSGPAGLAAAEELNLLGYQVTI
    Newman          ESIAIKGIERTIIDEAFENGWVAPKVPSRRRDEKVAIVGSGPAGLAAAEELNLLGYQVTI
    USA300_FPR3757  ESIAIKGIERTIIDEAFENGWVAPKVPSRRRDEKVAIVGSGPAGLAAAEELNLLGYQVTI
                    *********************************************:**************

    COL             YERARESGGLLMYGIPNMKLDKDVVRRRIKLMEEAGITFINGVEVGVDIDKATLESEYDA
    N315            YERARESGGLLMYGIPNMKLDKDVVRRRIKLMEEAGITFINGVEVGVDIDKATLESEYDA
    NCTC8325        YERARESGGLLMYGIPNMKLDKDVVRRRIKLMEEAGITFINGVEVGVDIDKATLESEYDA
    Newman          YERARESGGLLMYGIPNMKLDKDVVRRRIKLMEEAGITFINGVEVGVDIDKATLESEYDA
    USA300_FPR3757  YERARESGGLLMCGIPNMKLDKDVVRRRIKLMEEAGITFINGVEVGVDIDKATLESEYDA
                    ************ ***********************************************

    COL             IILCTGAQKGRDLPLEGRMGDGIHFAMDYLTEQTQLLNGEIDDITITAKDKNVIIIGAGD
    N315            IILCTGAQKGRDLPLEGRMGDGIHFAMDYLTEQTQLLNGEIDDITITAKDKNVIIIGAGD
    NCTC8325        IILCTGAQKGRDLPLEGRMGDGIHFAMDYLTEQTQLLNGEIDDITITAKDKNVIIIGAGD
    Newman          IILCTGAQKGRDLPLEGRMGDGIHFAMDYLTEQTQLLNGEIDDITITAKDKNVIIIGAGD
    USA300_FPR3757  IILCTGAQKGRDLPLEGRMGDGIHFAMDYLTEQTQLLNGEIDDITITAKDKNVIIIGAGD
                    ************************************************************

    COL             TGADCVATALRENCKSIVQFNKYTKLPEAITFTENASWPLAMPVFKMDYAHQEYEAKFGK
    N315            TGADCVATALRENCKSIVQFNKYTKLPEAITFTENASWPLAMPVFKMDYAHQEYEAKFGK
    NCTC8325        TGADCVATALRENCKSIVQFNKYTKLPEAITFTENASWPLAMPVFKMDYAHQEYEAKFGK
    Newman          TGADCVATALRENCKSIVQFNKYTKLPEAITFTENASWPLAMPVFKMDYAHQEYEAKFGK
    USA300_FPR3757  TGADCVATALRENCKSIVQFNKYTKLPEAITFTENASWPLAMPVFKMDYAHQEYEAKFGK
                    ************************************************************

    COL             EPRAYGVQTMRYDVDDKGHIRGLYTQILEQGENGMVMKEGPERFWPADLVLLSIGFEGTE
    N315            EPRAYGVQTMRYDVDDKGHIRGLYTQILEQGENGMVMKEGPERFWPADLVLLSIGFEGTE
    NCTC8325        EPRAYGVQTMRYDVDDKGHIRGLYTQILEQGENGMVMKEGPERFWPADLVLLSIGFEGTE
    Newman          EPRAYGVQTMRYDVDDKGHIRGLYTQILEQGENGMVMKEGPERFWPADLVLLSIGFEGTE
    USA300_FPR3757  EPRAYGVQTMRYDVDDKGHIRGLYTQILEQGENGMVMKEGPERFWPADLVLLSIGFEGTE
                    ************************************************************

    COL             PTVPNAFNIKTDRNRIVADDTNYQTNNEKVFAAGDARRGQSLVVWAIKEGRGVAKAVDQY
    N315            PTVPNAFNIKTDRNRIVADDTNYQTNNEKVFAAGDARRGQSLVVWAIKEGRGVAKAVDQY
    NCTC8325        PTVPNAFNIKTDRNRIVADDTNYQTNNEKVFAAGDARRGQSLVVWAIKEGRGVAKAVDQY
    Newman          PTVPNAFNIKTDRNRIVADDTNYQTNNEKVFAAGDARRGQSLVVWAIKEGRGVAKAVDQY
    USA300_FPR3757  PTVPNAFNIKTDRNRIVADDTNYQTNNEKVFAAGDARRGQSLVVWAIKEGRGVAKAVDQY
                    ************************************************************

    COL             LASKVCV
    N315            LASKVCV
    NCTC8325        LASKVCV
    Newman          LASKVCV
    USA300_FPR3757  LASKVCV
                    *******