From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002190000
  • symbol?: treP
  • description?: PTS ascorbate transporter subunit IIA

      descriptions from strain specific annotations:

    • PTS ascorbate transporter subunit IIA
    • PTS system, trehalose-specific IIBC component
    • PTS system, IIBC components
    • PTS trehalose-specific transporter subunit II
    • sugar-specific PTS transport system, IIBC component
    • phosphoenolpyruvate-dependent and trehalose-specific PTS enzyme II
    • pseudogene
    • PTS family trehalose (tre) porter component IIBC
    • PTS system, trehalose-specific IIB component / PTS system, trehalose-specific IIC component
    • PTS system sugar-specific transporter subunit IIBC
    • PTS system transporter subunit IIBC
    • PTS system trehalose-specific EIIBC component
    • PTS system trehalose-specific IIBC component
    • PTS system trehalose-specific transporter subunit IIBC
  • strand?: +
  • coordinates?: 2696302..2697739
  • synteny block?: BlockID0014910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0432 (treP)
    NCTC8325:
    Newman:
    NWMN_0438 (treP)
    USA300_FPR3757:
    04-02981:
    SA2981_0449 (treP)
    08BA02176:
    C248_0524
    11819-97:
    MS7_0448 (treP)
    71193:
    ST398NM01_0540
    ECT-R 2:
    ECTR2_408 (treP)
    ED133:
    SAOV_0492
    ED98:
    SAAV_0417
    HO 5096 0412:
    SAEMRSA15_03990
    JH1:
    SaurJH1_0508
    JH9:
    SaurJH9_0495
    JKD6008:
    SAA6008_00478
    JKD6159:
    SAA6159_00423
    LGA251:
    SARLGA251_04070
    M013:
    M013TW_0439
    MRSA252:
    SAR0473
    MSHR1132:
    SAMSHR1132_04180
    MSSA476:
    SAS0431
    Mu3:
    SAHV_0471 (treP)
    Mu50:
    SAV0474 (treP)
    MW2:
    MW0428 (treP)
    RF122:
    SAB0423
    ST398:
    SAPIG0540 (treP)
    T0131:
    SAT0131_00515
    TCH60:
    HMPREF0772_10048 (treP)
    TW20:
    SATW20_05420
    USA300_TCH1516:
    USA300HOU_0474 (treP)
    VC40:
    SAVC_01955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MAVKREDVKAIVTAIGGKENLEAATHCVTRLRLVLKDESKVDKDALSNNALVKGQFK
    N315            ---MAVKREDVKAIVSAIGGKENLEAATHCVTRLRLVLKDESKVDKDALSNNALVKGQFK
    NCTC8325        ---MAVKREDVKAIVTAIGGKENLEAATHCVTRLRLVLKDESKVDKDALSNNALVKGQFK
    Newman          MKYMAVKREDVKAIVTAIGGKENLEAATHCVTRLRLVLKDESKVDKDALSNNALVKGQFK
    USA300_FPR3757  ---MAVKREDVKAIVTAIGGKENLEAATHCVTRLRLVLKDESKVDKDALSNNALVKGQFK
                       ************:********************************************

    COL             ADHQYQIVIGPGTVDEVYKQFIDETGAQEASKDEAKQAAAQKGNPVQRLIKLLGDIFIPI
    N315            ADHQYQIVIGPGTVDEVYKQFIDETGAQEASKDEAKQAAAKKGNPVQRLIKLLGDIFIPI
    NCTC8325        ADHQYQIVIGPGTVDEVYKQFIDETGAQEASKDEAKQAAAQKGNPVQRLIKLLGDIFIPI
    Newman          ADHQYQIVIGPGTVDEVYKQFIDETGAQEASKDEAKQAAAQKGNPVQRLIKLLGDIFIPI
    USA300_FPR3757  ADHQYQIVIGPGTVDEVYKQFIDETGAQEASKDEAKQAAAQKGNPVQRLIKLLGDIFIPI
                    ****************************************:*******************

    COL             LPAIVTAGLLMGINNLLTMKGLFGPKALIEMYPQIADISNIINVIASTAFIFLPALIGWS
    N315            LPAIVTAGLLMGINNLLTMKGLFGPKALIEMYPQIADISNIINVIASTAFIFLPALIGWS
    NCTC8325        LPAIVTAGLLMGINNLLTMKGLFGPKALIEMYPQIADISNIINVIASTAFIFLPALIGWS
    Newman          LPAIVTAGLLMGINNLLTMKGLFGPKALIEMYPQIADISNIINVIASTAFIFLPALIGWS
    USA300_FPR3757  LPAIVTAGLLMGINNLLTMKGLFGPKALIEMYPQIADISNIINVIASTAFIFLPALIGWS
                    ************************************************************

    COL             SMRVFGGSPILGIVLGLILMHPQLVSQYDLAKGNIPTWNLFGLEIKQLNYQGQVLPVLIA
    N315            SMRVFGGSPILGIVLGLILMHPQLVSQYDLAKGNIPTWNLFGLEIKQLNYQGQVLPVLIA
    NCTC8325        SMRVFGGSPILGIVLGLILMHPQLVSQYDLAKGNIPTWNLFGLEIKQLNYQGQVLPVLIA
    Newman          SMRVFGGSPILGIVLGLILMHPQLVSQYDLAKGNIPTWNLFGLEIKQLNYQGQVLPVLIA
    USA300_FPR3757  SMRVFGGSPILGIVLGLILMHPQLVSQYDLAKGNIPTWNLFGLEIKQLNYQGQVLPVLIA
                    ************************************************************

    COL             AYVLAKIEKGLNKVVHDSIKMLVVGPVALLVTGFLAFIIIGPVALLIGTGITSGVTFIFQ
    N315            AYVLAKIEKGLNKVVHDSIKMLVVGPVALLVTGFLAFIIIGPVALLIGTGITSGVTFIFQ
    NCTC8325        AYVLAKIEKGLNKVVHDSIKMLVVGPVALLVTGFLAFIIIGPVALLIGTGITSGVTFIFQ
    Newman          AYVLAKIEKGLNKVVHDSIKMLVVGPVALLVTGFLAFIIIGPVALLIGTGITSGVTFIFQ
    USA300_FPR3757  AYVLAKIEKGLNKVVHDSIKMLVVGPVALLVTGFLAFIIIGPVALLIGTGITSGVTFIFQ
                    ************************************************************

    COL             HAGWLGGAIYGLLYAPLVITGLHHMFLAVDFQLMGSSLGGTYLWPIVAISNICQGSAAFG
    N315            HAGWLGGAIYGLLYAPLVITGLHHMFLAVDFQLMGSSLGGTYLWPIVAISNICQGSAAFG
    NCTC8325        HAGWLGGAIYGLLYAPLVITGLHHMFLAVDFQLMGSSLGGTYLWPIVAISNICQGSAAFG
    Newman          HAGWLGGAIYGLLYAPLVITGLHHMFLAVDFQLMGSSLGGTYLWPIVAISNICQGSAAFG
    USA300_FPR3757  HAGWLGGAIYGLLYAPLVITGLHHMFLAVDFQLMGSSLGGTYLWPIVAISNICQGSAAFG
                    ************************************************************

    COL             AWFVYKRRKMVKEEGLALTSCISGMLGVTEPAMFGVNLPLKYPFIAAISTSCVLGAIVGM
    N315            AWFVYKRRKMVKEEGLALTSCISAMLGVTEPAMFGVNLPLKYPFIAAISTSCVLGAIVGM
    NCTC8325        AWFVYKRRKMVKEEGLALTSCISGMLGVTEPAMFGVNLPLKYPFIAAISTSCVLGAIVGM
    Newman          AWFVYKRRKMVKEEGLALTSCISGMLGVTEPAMFGVNLPLKYPFIAAISTSCVLGAIVGM
    USA300_FPR3757  AWFVYKRRKMVKEEGLALTSCISGMLGVTEPAMFGVNLPLKYPFIAAISTSCVLGAIVGM
                    ***********************.************************************

    COL             NNVLGKVGVGGVPAFISIQKEFWPVYLIVTAIAIVVPCILTIVMSHFSKQKAKEIVED
    N315            NNVLGKVGVGGVPAFISIQKEFWPVYLIVTAIAIVVPCILTIVMSHFSKQKAKEIVED
    NCTC8325        NNVLGKVGVGGVPAFISIQKEFWPVYLIVTAIAIVVPCILTIVMSHFSKQKAKEIVED
    Newman          NNVLGKVGVGGVPAFISIQKEFWPVYLIVTAIAIVVPCILTIVMSHFSKQKAKEIVED
    USA300_FPR3757  NNVLGKVGVGGVPAFISIQKEFWPVYLIVTAIAIVVPCILTIVMSHFSKQKAKEIVED
                    **********************************************************