From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002191000
  • symbol?: treC
  • description?: glucohydrolase

      descriptions from strain specific annotations:

    • glucohydrolase
    • alpha,alpha-phosphotrehalase
    • alpha-amylase
    • alpha-glucosidase
    • alpha amylase family protein
    • putative glycosyl hydrolase
    • Trehalose-6-phosphate hydrolase
  • strand?: +
  • coordinates?: 2697803..2699443
  • synteny block?: BlockID0014920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0439 (treC)
    USA300_FPR3757:
    04-02981:
    SA2981_0450
    08BA02176:
    C248_0525
    11819-97:
    MS7_0449 (treC)
    71193:
    ST398NM01_0541
    ECT-R 2:
    ECTR2_409 (treC)
    ED133:
    SAOV_0493
    ED98:
    SAAV_0418
    HO 5096 0412:
    SAEMRSA15_04000
    JH1:
    SaurJH1_0509
    JH9:
    SaurJH9_0496
    JKD6008:
    SAA6008_00479 (treC)
    JKD6159:
    SAA6159_00424 (treC)
    LGA251:
    SARLGA251_04080
    M013:
    M013TW_0440
    MRSA252:
    SAR0474
    MSHR1132:
    SAMSHR1132_04190
    MSSA476:
    SAS0432
    Mu3:
    SAHV_0472
    Mu50:
    SAV0475
    MW2:
    MW0429
    RF122:
    SAB0424
    ST398:
    SAPIG0541 (treC)
    T0131:
    SAT0131_00516
    TCH60:
    HMPREF0772_10047 (treC)
    TW20:
    SATW20_05430
    USA300_TCH1516:
    USA300HOU_0475 (amyA)
    VC40:
    SAVC_01960

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKEIDWRKSVVYQIYPKSFNDTTGNGIGDINGIIEKLDYIKLLGVDYIWLTPVYESPMN
    N315            MSKEIDWRKSVVYQIYPKSFNDTTGNGIGDINGIIEKLDYIKLLGVDYIWLTPVYESPMN
    NCTC8325        MSKEIDWRKSVVYQIYPKSFNDTTGNGIGDINGIIEKLDYIKLLGVDYIWLTPVYESPMN
    Newman          MSKEIDWRKSVVYQIYPKSFNDTTGNGIGDINGIIEKLDYIKLLGVDYIWLTPVYESPMN
    USA300_FPR3757  MSKEIDWRKSVVYQIYPKSFNDTTGNGIGDINGIIEKLDYIKLLGVDYIWLTPVYESPMN
                    ************************************************************

    COL             DNGYDISNYLEINEDFGTMDDFEKLIKVAHQKDLKVMLDIVINHTSTEHEWFKEARKSKD
    N315            DNGYDISNYLEINEAFGTMDDFEKLIKVAHQKDLKVMLDIVINHTSTEHEWFKEARKSKD
    NCTC8325        DNGYDISNYLEINEDFGTMDDFEKLIKVAHQKDLKVMLDIVINHTSTEHEWFKEARKSKD
    Newman          DNGYDISNYLEINEDFGTMDDFEKLIKVAHQKDLKVMLDIVINHTSTEHEWFKEARKSKD
    USA300_FPR3757  DNGYDISNYLEINEDFGTMDDFEKLIKVAHQKDLKVMLDIVINHTSTEHEWFKEARKSKD
                    ************** *********************************************

    COL             NPYRDYYFFRSSEDGPPTNWHSKFGGNAWKYDSETDEYYLHLFDVSQADLNWDNPEVRQS
    N315            NPYRDYYFFRSSEDGPPTNWHSKFGGNAWKYDSETDEYYLHLFDVSQADLNWDNPEVRQS
    NCTC8325        NPYRDYYFFRSSEDGPPTNWHSKFGGNAWKYDSETDEYYLHLFDVSQADLNWDNPEVRQS
    Newman          NPYRDYYFFRSSEDGPPTNWHSKFGGNAWKYDSETDEYYLHLFDVSQADLNWDNPEVRQS
    USA300_FPR3757  NPYRDYYFFRSSEDGPPTNWYSKFGGNAWKYDSETDEYYLHLFDVSQADLNWDNPEVRQS
                    ********************:***************************************

    COL             LYRIVNHWIDFGVDGFRFDVINLISKGEFKDSDKIGKEFYTDGPRVHEFLHELNRQTFGN
    N315            LYRIVNHWIDFGVDGFRFDVINLISKGEFKDSDKIGKEFYTDGPRVHEFLHELNRQTFGN
    NCTC8325        LYRIVNHWIDFGVDGFRFDVINLISKGEFKDSDKIGKEFYTDGPRVHEFLHELNRQTFGN
    Newman          LYRIVNHWIDFGVDGFRFDVINLISKGEFKDSDKIGKEFYTDGPRVHEFLHELNRQTFGN
    USA300_FPR3757  LYRIVNHWIDFGVDGFRFDVINLISKGEFKDSDKIGKEFYTDGPRVHEFLHELNRQTFGN
                    ************************************************************

    COL             TDMMTIGEMSSTTIENCIKYTQPERQELNSVFNFHHLKVDYVDGEKWTNAKLDFHKLKEI
    N315            TDMMTVGEMSSTTIENCIKYTQPERQELNSVFNFHHLKVDYVDGEKWTNAKLDFHKLKEI
    NCTC8325        TDMMTIGEMSSTTIENCIKYTQPERQELNSVFNFHHLKVDYVDGEKWTNAKLDFHKLKEI
    Newman          TDMMTIGEMSSTTIENCIKYTQPERQELNSVFNFHHLKVDYVDGEKWTNAKLDFHKLKEI
    USA300_FPR3757  TDMMTIGEMSSTTIENCIKYTQPERQELNSVFNFHHLKVDYVDGEKWTNAKLDFHKLKEI
                    *****:******************************************************

    COL             LMQWQRGIYDGGGWNAIFWCNHDQPRVVSRFGDDTSEEMRIQSAKMLAIALHMLQGTPYI
    N315            LMQWQRGIYDGGGWNAIFWCNHDQPRVVSRFGDDTSEEMRIQSAKMLAIALHMLQGTPYI
    NCTC8325        LMQWQRGIYDGGGWNAIFWCNHDQPRVVSRFGDDTSEEMRIQSAKMLAIALHMLQGTPYI
    Newman          LMQWQRGIYDGGGWNAIFWCNHDQPRVVSRFGDDTSEEMRIQSAKMLAIALHMLQGTPYI
    USA300_FPR3757  LMQWQRGIYDGGGWNAIFWCNHDQPRVVSRFGDDTSEEMRIQSAKMLAIALHMLQGTPYI
                    ************************************************************

    COL             YQGEEIGMTDPHFTSIAQYRDVESINAYHQLLSEGHAEADVLAILGQKSRDNSRTPMQWS
    N315            YQGEEIGMTDPHFTSIAQYRDVESINAYHQLLSEGHAEADVLAILGQKSRDNSRTPMQWS
    NCTC8325        YQGEEIGMTDPHFTSIAQYRDVESINAYHQLLSEGHAEADVLAILGQKSRDNSRTPMQWS
    Newman          YQGEEIGMTDPHFTSIAQYRDVESINAYHQLLSEGHAEADVLAILGQKSRDNSRTPMQWS
    USA300_FPR3757  YQGEEIGMTDPHFTSIAQYRDVESINAYHQLLSEGHAEADVLAILGQKSRDNSRTPMQWS
                    ************************************************************

    COL             DDVNAGFTAGKPWIDISENYHQVNVRQALQNKESIFYTYQKLIQLRHTHDIITYGDIVPR
    N315            DDVNAGFTAGKPWIDISENYHQVNVRQALQNKESIFYTYQKLIQLRHTHDIITYGDIVPR
    NCTC8325        DDVNAGFTAGKPWIDISENYHQVNVRQALQNKESIFYTYQKLIQLRHTHDIITYGDIVPR
    Newman          DDVNAGFTAGKPWIDISENYHQVNVRQALQNKESIFYTYQKLIQLRHTHDIITYGDIVPR
    USA300_FPR3757  DDVNAGFTAGKPWIDISENYHQVNVRQALQNKESIFYTYQKLIQLRHTHDIITYGDIVPR
                    ************************************************************

    COL             FMDHDHLFVYERHYKNQQWLVIANFSASAVDLPEGLAREGCVVIQTGTVENNTISGFGAI
    N315            FMDHDHLFVYERHYKNQQWLVIANFSASAVDLPEGLAREGCVVIQTGTVENNTISGFGAI
    NCTC8325        FMDHDHLFVYERHYKNQQWLVIANFSASAVDLPEGLAREGCVVIQTGTVENNTISGFGAI
    Newman          FMDHDHLFVYERHYKNQQWLVIANFSASAVDLPEGLAREGCVVIQTGTVENNTISGFGAI
    USA300_FPR3757  FMDHDHLFVYERHYKNQQWLVIANFSASAVDLPEGLAREGCVVIQTGTVENNTISGFGAI
                    ************************************************************

    COL             VIETNA
    N315            VIETNA
    NCTC8325        VIETNA
    Newman          VIETNA
    USA300_FPR3757  VIETNA
                    ******