From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002200000
  • symbol?: recR
  • description?: recombination protein RecR

      descriptions from strain specific annotations:

    • recombination protein RecR
    • putative recombination protein
    • RecR protein
  • strand?: +
  • coordinates?: 2705109..2705705
  • synteny block?: BlockID0015010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0522 (recR)
    N315:
    SA0438 (recR)
    NCTC8325:
    Newman:
    NWMN_0444 (recR)
    USA300_FPR3757:
    04-02981:
    SA2981_0455 (recR)
    08BA02176:
    C248_0531 (recR)
    11819-97:
    MS7_0454 (recR)
    71193:
    ST398NM01_0546
    ECT-R 2:
    ECTR2_415 (recR)
    ED133:
    SAOV_0498
    ED98:
    SAAV_0424 (recR)
    HO 5096 0412:
    SAEMRSA15_04060 (recR)
    JH1:
    SaurJH1_0514 (recR)
    JH9:
    SaurJH9_0501 (recR)
    JKD6008:
    SAA6008_00484 (recR)
    JKD6159:
    SAA6159_00429 (recR)
    LGA251:
    SARLGA251_04130 (recR)
    M013:
    M013TW_0445
    MRSA252:
    SAR0479 (recR)
    MSHR1132:
    SAMSHR1132_04240
    MSSA476:
    SAS0437 (recR)
    Mu3:
    SAHV_0477 (recR)
    Mu50:
    SAV0480 (recR)
    MW2:
    MW0435 (recR)
    RF122:
    SAB0429 (recR)
    ST398:
    SAPIG0546 (recR)
    T0131:
    SAT0131_00521
    TCH60:
    HMPREF0772_10042 (recR)
    TW20:
    SATW20_05480 (recR)
    USA300_TCH1516:
    USA300HOU_0479 (recR)
    VC40:
    SAVC_01985 (recR)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
    N315            MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
    NCTC8325        MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
    Newman          MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
    USA300_FPR3757  MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAKALVDVKRELTYCSVC
                    ************************************************************

    COL             GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
    N315            GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
    NCTC8325        GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
    Newman          GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
    USA300_FPR3757  GHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLYHVLHGSISPMDGIGPE
                    ************************************************************

    COL             DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
    N315            DINIPSLIERLKSDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
    NCTC8325        DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
    Newman          DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
    USA300_FPR3757  DINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPIGIKVTRLAQGLSVGGDL
                    ************.***********************************************

    COL             EYADEVTLSKAIAGRTEM
    N315            EYADEVTLSKAIAGRTEM
    NCTC8325        EYADEVTLSKAIAGRTEM
    Newman          EYADEVTLSKAIAGRTEM
    USA300_FPR3757  EYADEVTLSKAIAGRTEM
                    ******************