Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002219000
  • symbol?: holB
  • description?: DNA polymerase III subunit delta'

      descriptions from strain specific annotations:

    • DNA polymerase III subunit delta'
    • DNA polymerase III delta prime subunit
    • DNA-directed DNA polymerase
    • DNA polymerase III, delta prime subunit, putative
    • DNA polymerase III delta subunit
    • putative DNA polymerase III, delta' subunit
    • DNA-directed DNA polymerase III delta' subunit
    • DNA polymerase III subunits gamma and tau domain III family protein
    • DNA-directed DNA polymerase III subunit delta'
  • strand?: +
  • coordinates?: 2731906..2732832
  • synteny block?: BlockID0015180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0442 (holB)
    NCTC8325:
    Newman:
    NWMN_0448 (holB)
    USA300_FPR3757:
    04-02981:
    SA2981_0459 (holB)
    08BA02176:
    C248_0538 (holB)
    11819-97:
    MS7_0461
    71193:
    ST398NM01_0550
    ECT-R 2:
    ECTR2_424
    ED133:
    SAOV_0505
    ED98:
    SAAV_0430
    HO 5096 0412:
    SAEMRSA15_04100 (holB)
    JH1:
    SaurJH1_0518
    JH9:
    SaurJH9_0505
    JKD6008:
    SAA6008_00488 (holB)
    JKD6159:
    SAA6159_00435 (holB)
    LGA251:
    SARLGA251_04180 (holB)
    M013:
    M013TW_0453
    MRSA252:
    SAR0485 (holB)
    MSHR1132:
    SAMSHR1132_04280
    MSSA476:
    SAS0441
    Mu3:
    SAHV_0481 (holB)
    Mu50:
    SAV0484 (holB)
    MW2:
    MW0439 (holB)
    RF122:
    SAB0433 (holB)
    ST398:
    SAPIG0550
    T0131:
    SAT0131_00528 (ribB)
    TCH60:
    HMPREF0772_10037 (holB)
    TW20:
    SATW20_05520 (holB)
    USA300_TCH1516:
    USA300HOU_0483 (holB)
    VC40:
    SAVC_02005

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDEQQQLTNAYHSNKLSHAYLFEGDDAQTMKQVAINFAKLILCQTDSQCETKVSTYNHPD
    N315            MDEQQQLTNAYHSNKLSHAYLFEGDDAQTMKQVAINFAKLILCQTDSQCETKVSTYNHPD
    NCTC8325        -----------------------------MKQVAINFAKLILCQTDSQCETKVSTYNHPD
    Newman          MDEQQQLTNAYHSNKLSHAYLFEGDDAQTMKQVAINFAKLILCQTDSQCETKVSTYNHPD
    USA300_FPR3757  MDEQQQLTNAYHSNKLSHAYLFEGDDAQTMKQVAINFAKLILCQTDSQCETKVSTYNHPD
                                                 *******************************

    COL             FMYISTTENAIKKEQVEQLVRHMNQLPIESTNKVYIIEDFEKLTVQGENSILKFLEEPPD
    N315            FMYISTTENAIKKEQVEQLVRHMNQLPIESTNKVYIIEDFEKLTVQGENSILKFLEEPPD
    NCTC8325        FMYISTTENAIKKEQVEQLVRHMNQLPIESTNKVYIIEDFEKLTVQGENSILKFLEEPPD
    Newman          FMYISTTENAIKKEQVEQLVRHMNQLPIESTNKVYIIEDFEKLTVQGENSILKFLEEPPD
    USA300_FPR3757  FMYISTTENAIKKEQVEQLVRHMNQLPIESTNKVYIIEDFEKLTVQGENSILKFLEEPPD
                    ************************************************************

    COL             NTIAILLSTKPEQILDTIHSRCQHVYFKPIDKEKFINRLVEQNMSKPVAEMISTYTTQID
    N315            NTIAILLSTKPEQILDTIHSRCQHVYFKPIDKEKFINRLVEQNMSKPVAEMISTYTTQID
    NCTC8325        NTIAILLSTKPEQILDTIHSRCQHVYFKPIDKEKFINRLVEQNMSKPVAEMISTYTTQID
    Newman          NTIAILLSTKPEQILDTIHSRCQHVYFKPIDKEKFINRLVEQNMSKPVAEMISTYTTQID
    USA300_FPR3757  NTIAILLSTKPEQILDTIHSRCQHVYFKPIDKEKFINRLVEQNMSKPVAEMISTYTTQID
                    ************************************************************

    COL             NAMALNEEFDLLALRKSVIRWCELLLTNKPMALIGIIDLLKQAKNKKLQSLTIAAVNGFF
    N315            NAIALNEEFDLLALRKSVIRWCELLLTNKPMALIGIIDLLKQAKNKKLQSLTIAAVNGFF
    NCTC8325        NAMALNEEFDLLALRKSVIRWCELLLTNKPMALIGIIDLLKQAKNKKLQSLTIAAVNGFF
    Newman          NAMALNEEFDLLALRKSVIRWCELLLTNKPMALIGIIDLLKQAKNKKLQSLTIAAVNGFF
    USA300_FPR3757  NAMALNEEFDLLALRKSVIRWCELLLTNKPMALIGIIDLLKQAKNKKLQSLTIAAVNGFF
                    **:*********************************************************

    COL             EDIIHTKVNVEDKQIYSDLKNDIDQYAQKLSFNQLILMFDQLTEAHKKLNQNVNPTLVFE
    N315            EDIIHTKVNVEDKQIYSDLKNDIDQYAQKLSFNQLFLMFDQLTEAHKKLNQNVNPTLVFE
    NCTC8325        EDIIHTKVNVEDKQIYSDLKNDIDQYAQKLSFNQLILMFDQLTEAHKKLNQNVNPTLVFE
    Newman          EDIIHTKVNVEDKQIYSDLKNDIDQYAQKLSFNQLILMFDQLTEAHKKLNQNVNPTLVFE
    USA300_FPR3757  EDIIHTKVNVEDKQIYSDLKNDIDQYAQKLSFNQLILMFDQLTEAHKKLNQNVNPTLVFE
                    ***********************************:************************

    COL             QIVIKGVS
    N315            QIVIKGVS
    NCTC8325        QIVIKGVS
    Newman          QIVIKGVS
    USA300_FPR3757  QIVIKGVS
                    ********