From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002247000
  • symbol?:
  • description?: S4 domain-containing protein

      descriptions from strain specific annotations:

    • S4 domain-containing protein
    • Heat shock protein 15
    • ribosome-associated heat shock protein
    • RNA-binding S4 domain-containing heat shock protein
    • RNA-binding S4 domain-containing protein
    • S4-domain-containing heat shock protein
  • strand?: +
  • coordinates?: 2755746..2756009
  • synteny block?: BlockID0015460
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0481
    08BA02176:
    C248_0562
    11819-97:
    MS7_0483
    71193:
    ST398NM01_0572
    ECT-R 2:
    ECTR2_446
    ED133:
    SAOV_0528
    ED98:
    SAAV_0453
    HO 5096 0412:
    SAEMRSA15_04320
    JH1:
    SaurJH1_0541
    JH9:
    SaurJH9_0528
    JKD6008:
    SAA6008_00511
    JKD6159:
    SAA6159_00457
    LGA251:
    SARLGA251_04400
    M013:
    M013TW_0478
    MRSA252:
    SAR0507
    MSHR1132:
    SAMSHR1132_04500
    MSSA476:
    SAS0463
    Mu3:
    SAHV_0503
    Mu50:
    SAV0506
    MW2:
    MW0461
    RF122:
    SAB0455
    ST398:
    SAPIG0572
    T0131:
    SAT0131_00552
    TCH60:
    HMPREF0772_10013
    TW20:
    SATW20_05740
    USA300_TCH1516:
    USA300HOU_0500
    VC40:
    SAVC_02115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVEDVLTIRFGQKLVTVKV
    N315            MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVEDVLTIRFGQKLVTVKV
    NCTC8325        MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVEDVLTIRFGQKLVTVKV
    USA300_FPR3757  MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVEDVLTIRFGQKLVTVKV
                    ************************************************************

    COL             TALNEHASKDNAKGMYEIIEERRLEEA
    N315            TALNEHASKDNAKGMYEIIEERRLEEA
    NCTC8325        TALNEHASKDNAKGMYEIIEERRLEEA
    USA300_FPR3757  TALNEHASKDNAKGMYEIIEERRLEEA
                    ***************************