From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00481
  • pan locus tag?: SAUPAN002247000
  • symbol: SAOUHSC_00481
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00481
  • symbol: SAOUHSC_00481
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 479937..480200
  • length: 264
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAGATTAGATAAATATTTAAAAGTATCACGGTTAATAAAGCGACGTACGCTAGCAAAA
    GAAGTAAGTGATCAAGGTAGAATTACAATAAATGGTAATGTTGCTAAAGCTGGATCGGAT
    GTTAAAGTTGAAGATGTGCTGACGATTCGCTTTGGTCAAAAATTAGTAACAGTTAAAGTA
    ACTGCATTAAATGAACATGCATCTAAAGATAACGCGAAGGGTATGTATGAAATCATTGAA
    GAGCGTCGACTTGAAGAAGCGTAA
    60
    120
    180
    240
    264

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00481
  • symbol: SAOUHSC_00481
  • description: hypothetical protein
  • length: 87
  • theoretical pI: 10.3609
  • theoretical MW: 9856.36
  • GRAVY: -0.478161

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Stress ResponseHeat shockHeat shock dnaK gene cluster extended Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) 
    Cell division-ribosomal stress proteins cluster Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) 
  • PFAM:
    S4 (CL0492) S4; S4 domain (PF01479; HMM-score: 35.7)
    S4_2; S4 domain (PF13275; HMM-score: 14.9)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.238
    • Ymax_pos: 11
    • Cmax: 0.157
    • Cmax_pos: 38
    • Smax: 0.687
    • Smax_pos: 2
    • Smean: 0.563
    • D: 0.365
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVEDVLTIRFGQKLVTVKVTALNEHASKDNAKGMYEIIEERRLEEA

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 1.131 1.132 1.133 1.134 1.135 1.136 1.137 1.138 1.139 1.140 1.141 1.142 1.143 1.144 1.145 1.146 1.147 1.148 1.149 1.150 1.151 1.152 1.153 1.154 1.155 1.156 1.157 1.158 1.159 1.160 1.161 1.162 1.163 1.164 1.165 1.166 1.167 1.168 1.169 1.170 1.171 1.172 1.173 1.174 1.175 1.176 1.177 1.178

Relevant publications[edit source | edit]