From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00520
  • pan locus tag?: SAUPAN002310000
  • symbol: rplJ
  • pan gene symbol?: rplJ
  • synonym:
  • product: 50S ribosomal protein L10

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_00520
  • symbol: rplJ
  • product: 50S ribosomal protein L10
  • replicon: chromosome
  • strand: +
  • coordinates: 520251..520751
  • length: 501
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTCTGCTATCATTGAAGCTAAAAAACAACTAGTTGATGAAATTGCTGAGGTACTATCA
    AATTCAGTTTCAACAGTAATCGTTGACTACCGTGGATTAACAGTAGCTGAAGTTACTGAC
    TTACGTTCACAATTACGTGAAGCTGGTGTTGAGTATAAAGTATACAAAAACACTATGGTA
    CGTCGTGCAGCTGAAAAAGCTGGTATCGAAGGCTTAGATGAATTCTTAACAGGTCCTACT
    GCTATTGCAACTTCAAGTGAAGATGCTGTAGCTGCAGCGAAAGTAATTTCTGGATTTGCT
    AAAGATCATGAAGCATTAGAAATTAAATCAGGCGTTATGGAAGGCAATGTTATTACAGCA
    GAAGAAGTTAAAACTGTTGGTTCATTACCTTCACACGATGGTCTTGTATCTATGCTTTTA
    TCAGTATTACAAGCTCCTGTACGCAACTTCGCTTATGCGGTTAAAGCTATTGGAGAACAA
    AAAGAAGAAAACGCTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_00520
  • symbol: RplJ
  • description: 50S ribosomal protein L10
  • length: 166
  • theoretical pI: 4.49215
  • theoretical MW: 17710
  • GRAVY: 0.0246988

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA aminoacylationserine--tRNA ligase (TIGR00415; EC 6.1.1.11; HMM-score: 10.8)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome LSU bacterial LSU ribosomal protein L10p (P0) 
  • PFAM:
    no clan definedRibosomal_L10; Ribosomal protein L10 (PF00466; HMM-score: 103)
    P-loop_NTPase (CL0023) AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.105
    • Ymax_pos: 49
    • Cmax: 0.127
    • Cmax_pos: 64
    • Smax: 0.154
    • Smax_pos: 35
    • Smean: 0.091
    • D: 0.099
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQLREAGVEYKVYKNTMVRRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHEALEIKSGVMEGNVITAEEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEENAE

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9

Relevant publications[edit source | edit]