From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01819
  • pan locus tag?: SAUPAN004362000
  • symbol: SAOUHSC_01819
  • pan gene symbol?: uspA1
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01819
  • symbol: SAOUHSC_01819
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1724792..1725292
  • length: 501
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTACTTACAAAAATATTTTAATCGCAGTTGACGGTTCACATGAAGCGGAATGGGCA
    TTTAACAGAGCAGTTGGTGTTGCTAAACGTAACGATGCGAAGTTAACAATTGTGAATGTA
    ATTGATTCAAGAACGTATTCTTCTTATGAAGTTTATGATGCTCAATTTACTGAAAAATCT
    AAGCATTTTGCAGAAGAATTATTAAATGGTTATAAAGAAGTAGCTACTAACGCTGGTGTT
    AAAGATGTAGAAACGCGTCTAGAGTTTGGCTCTCCTAAATCTATCATTCCTAAAAAGCTT
    GCACATGAAATTAATGCAGACTTGATTATGAGTGGTACATCAGGCTTAAATGCCGTGGAA
    AGATTTATTGTTGGTTCTGTATCAGAATCTATCGTTCGTCATGCGCCATGTGACGTGTTA
    GTTGTTCGTACTGAAGAGTTACCAGCAGACTTCCAACCACAAGTTGCAACAACTCAATTA
    CGTGAAAAATATCAAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01819
  • symbol: SAOUHSC_01819
  • description: hypothetical protein
  • length: 166
  • theoretical pI: 5.67748
  • theoretical MW: 18474.7
  • GRAVY: -0.259639

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairdeoxyribodipyrimidine photolyase (TIGR00591; EC 4.1.99.3; HMM-score: 16.1)
  • TheSEED:  
    Stress ResponseStress Response - no subcategoryUniversal stress protein family Universal stress protein family 
  • PFAM:
    HUP (CL0039) Usp; Universal stress protein family (PF00582; HMM-score: 123.4)
    no clan definedDUF693; Protein of unknown function (DUF693) (PF05113; HMM-score: 14.5)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.121
    • Ymax_pos: 20
    • Cmax: 0.116
    • Cmax_pos: 20
    • Smax: 0.194
    • Smax_pos: 16
    • Smean: 0.108
    • D: 0.116
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MITYKNILIAVDGSHEAEWAFNRAVGVAKRNDAKLTIVNVIDSRTYSSYEVYDAQFTEKSKHFAEELLNGYKEVATNAGVKDVETRLEFGSPKSIIPKKLAHEINADLIMSGTSGLNAVERFIVGSVSESIVRHAPCDVLVVRTEELPADFQPQVATTQLREKYQN

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SAOUHSC_01819 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24

Relevant publications[edit source | edit]