From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002252000
  • symbol?: ftsH
  • description?: zinc metalloprotease

      descriptions from strain specific annotations:

    • zinc metalloprotease
    • cell division protein FtsH
    • cell-division protein
    • ATP-dependent metalloprotease FtsH
    • putative cell division protein FtsH
    • ATP-dependent zinc metalloprotease FtsH
    • cell division protease ftsH
    • cell-division protein (ATP-dependent Zn metallopeptidase)
    • cell division protein FtsH, putative
    • putative Cell division protease FtsH homolog
    • putative cell division protein
  • strand?: +
  • coordinates?: 2759205..2761298
  • synteny block?: BlockID0015510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0469 (ftsH)
    NCTC8325:
    Newman:
    NWMN_0473 (ftsH)
    USA300_FPR3757:
    04-02981:
    SA2981_0486 (ftsH)
    08BA02176:
    C248_0567 (ftsH)
    11819-97:
    MS7_0488 (ftsH)
    71193:
    ST398NM01_0577
    ECT-R 2:
    ECTR2_451 (hflB)
    ED133:
    SAOV_0533
    ED98:
    SAAV_0458
    HO 5096 0412:
    SAEMRSA15_04370 (ftsH)
    JH1:
    SaurJH1_0546
    JH9:
    SaurJH9_0533
    JKD6008:
    SAA6008_00516 (ftsH)
    JKD6159:
    SAA6159_00462 (ftsH)
    LGA251:
    SARLGA251_04450 (ftsH)
    M013:
    M013TW_0483
    MRSA252:
    SAR0512 (ftsH)
    MSHR1132:
    SAMSHR1132_04550
    MSSA476:
    SAS0468
    Mu3:
    SAHV_0508 (ftsH)
    Mu50:
    SAV0511 (ftsH)
    MW2:
    MW0466 (ftsH)
    RF122:
    SAB0460 (ftsH)
    ST398:
    SAPIG0577
    T0131:
    SAT0131_00558
    TCH60:
    HMPREF0772_10008 (ftsH)
    TW20:
    SATW20_05790 (ftsH)
    USA300_TCH1516:
    USA300HOU_0505 (ftsH)
    VC40:
    SAVC_02140

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQKAFRNVLVIVIIGVIIFGLFSYLNGNGNMPKQLTYNQFTEKLEKGDLKTLEIQPQQNV
    N315            MQKAFRNVLVIVIIGVIIFGLFSYLNGNGNMPKQLTYNQFTEKLEKGDLKTLEIQPQQNV
    NCTC8325        MQKAFRNVLVIVIIGVIIFGLFSYLNGNGNMPKQLTYNQFTEKLEKGDLKTLEIQPQQNV
    Newman          MQKAFRNVLVIVIIGVIIFGLFSYLNGNGNMPKQLTYNQFTEKLEKGDLKTLEIQPQQNV
    USA300_FPR3757  MQKAFRNVLVIVIIGVIIFGLFSYLNGNGNMPKQLTYNQFTEKLEKGDLKTLEIQPQQNV
                    ************************************************************

    COL             YMVSGKTKNDEDYSSTILYNNEKELQKITDAAKKQNGVKLTIKEEEKQSVFVSILSTLIP
    N315            YMVSGKTKNDEDYSSTILYNNEKELQKITDAAKKQNGVKLTIKEEEKQSVFVSILSTLIP
    NCTC8325        YMVSGKTKNDEDYSSTILYNNEKELQKITDAAKKQNGVKLTIKEEEKQSVFVSILSTLIP
    Newman          YMVSGKTKNDEDYSSTILYNNEKELQKITDAAKKQNGVKLTIKEEEKQSVFVSILSTLIP
    USA300_FPR3757  YMVSGKTKNDEDYSSTILYNNEKELQKITDAAKKQNGVKLTIKEEEKQSVFVSILSTLIP
                    ************************************************************

    COL             VVVIALLFIFFLSQAQGGGSGGRMMNFGKSKAKMYDNNKRRVRFSDVAGADEEKQELIEI
    N315            VVVIALLFIFFLSQAQGGGSGGRMMNFGKSKAKMYDNNKRRVRFSDVAGADEEKQELIEI
    NCTC8325        VVVIALLFIFFLSQAQGGGSGGRMMNFGKSKAKMYDNNKRRVRFSDVAGADEEKQELIEI
    Newman          VVVIALLFIFFLSQAQGGGSGGRMMNFGKSKAKMYDNNKRRVRFSDVAGADEEKQELIEI
    USA300_FPR3757  VVVIALLFIFFLSQAQGGGSGGRMMNFGKSKAKMYDNNKRRVRFSDVAGADEEKQELIEI
                    ************************************************************

    COL             VDFLKDNKKFKEMGSRIPKGVLLVGPPGTGKTLLARAVAGEAGAPFFSISGSDFVEMFVG
    N315            VDFLKDNKKFKEMGSRIPKGVLLVGPPGTGKTLLARAVAGEAGAPFFSISGSDFVEMFVG
    NCTC8325        VDFLKDNKKFKEMGSRIPKGVLLVGPPGTGKTLLARAVAGEAGAPFFSISGSDFVEMFVG
    Newman          VDFLKDNKKFKEMGSRIPKGVLLVGPPGTGKTLLARAVAGEAGAPFFSISGSDFVEMFVG
    USA300_FPR3757  VDFLKDNKKFKEMGSRIPKGVLLVGPPGTGKTLLARAVAGEAGAPFFSISGSDFVEMFVG
                    ************************************************************

    COL             VGASRVRDLFDNAKKNAPCIIFIDEIDAVGRQRGAGVGGGHDEREQTLNQLLVEMDGFGE
    N315            VGASRVRDLFDNAKKNAPCIIFIDEIDAVGRQRGAGVGGGHDEREQTLNQLLVEMDGFGE
    NCTC8325        VGASRVRDLFDNAKKNAPCIIFIDEIDAVGRQRGAGVGGGHDEREQTLNQLLVEMDGFGE
    Newman          VGASRVRDLFDNAKKNAPCIIFIDEIDAVGRQRGAGVGGGHDEREQTLNQLLVEMDGFGE
    USA300_FPR3757  VGASRVRDLFDNAKKNAPCIIFIDEIDAVGRQRGAGVGGGHDEREQTLNQLLVEMDGFGE
                    ************************************************************

    COL             NEGIIMIAATNRPDILDPALLRPGRFDRQIQVGRPDVKGREAILHVHAKNKPLDETVDLK
    N315            NEGIIMIAATNRPDILDPALLRPGRFDRQIQVGRPDVKGREAILHVHAKNKPLDETVDLK
    NCTC8325        NEGIIMIAATNRPDILDPALLRPGRFDRQIQVGRPDVKGREAILHVHAKNKPLDETVDLK
    Newman          NEGIIMIAATNRPDILDPALLRPGRFDRQIQVGRPDVKGREAILHVHAKNKPLDETVDLK
    USA300_FPR3757  NEGIIMIAATNRPDILDPALLRPGRFDRQIQVGRPDVKGREAILHVHAKNKPLDETVDLK
                    ************************************************************

    COL             AISQRTPGFSGADLENLLNEASLIAVREGKKKIDMRDIEEATDRVIAGPAKKSRVISKKE
    N315            AISQRTPGFSGADLENLLNEASLIAVREGKKKIDMRDIEEATDRVIAGPAKKSRVISKKE
    NCTC8325        AISQRTPGFSGADLENLLNEASLIAVREGKKKIDMRDIEEATDRVIAGPAKKSRVISKKE
    Newman          AISQRTPGFSGADLENLLNEASLIAVREGKKKIDMRDIEEATDRVIAGPAKKSRVISKKE
    USA300_FPR3757  AISQRTPGFSGADLENLLNEASLIAVREGKKKIDMRDIEEATDRVIAGPAKKSRVISKKE
                    ************************************************************

    COL             RNIVAHHEAGHTIIGMVLDEAEVVHKVTIVPRGQAGGYAMMLPKQDRFLMTEQELLDKIC
    N315            RNIVAHHEAGHTIIGMVLDEAEVVHKVTIVPRGQAGGYAMMLPKQDRFLMTEQELLDKIC
    NCTC8325        RNIVAHHEAGHTIIGMVLDEAEVVHKVTIVPRGQAGGYAMMLPKQDRFLMTEQELLDKIC
    Newman          RNIVAHHEAGHTIIGMVLDEAEVVHKVTIVPRGQAGGYAMMLPKQDRFLMTEQELLDKIC
    USA300_FPR3757  RNIVAHHEAGHTIIGMVLDEAEVVHKVTIVPRGQAGGYAMMLPKQDRFLMTEQELLDKIC
                    ************************************************************

    COL             GLLGGRVSEDINFNEVSTGASNDFERATQIARSMVTQYGMSKKLGPLQFGHSNGQVFLGK
    N315            GLLGGRVSEDINFNEVSTGASNDFERATQIARSMVTQYGMSKKLGPLQFGHSNGQVFLGK
    NCTC8325        GLLGGRVSEDINFNEVSTGASNDFERATQIARSMVTQYGMSKKLGPLQFGHSNGQVFLGK
    Newman          GLLGGRVSEDINFNEVSTGASNDFERATQIARSMVTQYGMSKKLGPLQFGHSNGQVFLGK
    USA300_FPR3757  GLLGGRVSEDINFNEVSTGASNDFERATQIARSMVTQYGMSKKLGPLQFGHSNGQVFLGK
                    ************************************************************

    COL             DMQGEPNYSSQIAYEIDKEVQRIVKEQYERCKQILLEHKEQLILIAETLLTEETLVAEQI
    N315            DMQGEPNYSSQIAYEIDKEVQRIVKEQYERCKQILLEHKEQLILIAETLLTEETLVAEQI
    NCTC8325        DMQGEPNYSSQIAYEIDKEVQRIVKEQYERCKQILLEHKEQLILIAETLLTEETLVAEQI
    Newman          DMQGEPNYSSQIAYEIDKEVQRIVKEQYERCKQILLEHKEQLILIAETLLTEETLVAEQI
    USA300_FPR3757  DMQGEPNYSSQIAYEIDKEVQRIVKEQYERCKQILLEHKEQLILIAETLLTEETLVAEQI
                    ************************************************************

    COL             QSLFYEGKLPEIDYDAAKVVKDEDSEFNDGKFGKSYEEIRKEQLEDGQRDESEDRKEEKD
    N315            QSLFYEGKLPEIDYDAAKVVKDEDSEFNDGKFGKSYEEIRKEQLEDGQRDESEDRKEEKD
    NCTC8325        QSLFYEGKLPEIDYDAAKVVKDEDSEFNDGKFGKSYEEIRKEQLEDGQRDESEDRKEEKD
    Newman          QSLFYEGKLPEIDYDAAKVVKDEDSEFNDGKFGKSYEEIRKEQLEDGQRDESEDRKEEKD
    USA300_FPR3757  QSLFYEGKLPEIDYDAAKVVKDEDSEFNDGKFGKSYEEIRKEQLEDGQRDESEDRKEEKD
                    ************************************************************

    COL             IAEDKKEADKSDEKDEPAHQQAPNIEKPYDPNHPDNK
    N315            IAEDKKEADKSDEKDEPAHRQAPNIEKPYDPNHPDNK
    NCTC8325        IAEDKKEADKSDEKDEPAHRQAPNIEKPYDPNHPDNK
    Newman          IAEDKKEADKSDEKDEPAHQQAPNIEKPYDPNHPDNK
    USA300_FPR3757  IAEDKKEADKSDEKDEPAHQQAPNIEKPYDPNHPDNK
                    *******************:*****************