From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002255000
  • symbol?: cysK
  • description?: cysteine synthase

      descriptions from strain specific annotations:

    • cysteine synthase
    • cysteine synthase #o-acetylserine sulfhydrylase homologue
    • cysteine synthase A
    • O-acetylserine (thiol)-lyase
    • cysteine synthase-like protein
    • putative O-acetylserine (thiol)-lyase
    • cysteine synthase (o-acetylserine sulfhydrylase), CysK
    • beta-cyano-L-alanine synthase
  • strand?: +
  • coordinates?: 2763113..2764054
  • synteny block?: BlockID0015540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0557 (cysK)
    N315:
    SA0471 (cysK)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0488 (cysK)
    08BA02176:
    C248_0569 (cysK)
    11819-97:
    MS7_0490 (cysK)
    71193:
    ST398NM01_0579
    ECT-R 2:
    ECTR2_453 (cysK)
    ED133:
    SAOV_0535 (cysK)
    ED98:
    SAAV_0460 (cysK)
    HO 5096 0412:
    SAEMRSA15_04390
    JH1:
    SaurJH1_0548
    JH9:
    SaurJH9_0535
    JKD6008:
    SAA6008_00518 (cysK)
    JKD6159:
    SAA6159_00464 (cysK)
    LGA251:
    SARLGA251_04470
    M013:
    M013TW_0485
    MRSA252:
    SAR0514
    MSHR1132:
    SAMSHR1132_04570
    MSSA476:
    SAS0470
    Mu3:
    SAHV_0510 (cysK)
    Mu50:
    SAV0513 (cysK)
    MW2:
    MW0468 (cysK)
    RF122:
    SAB0462
    ST398:
    SAPIG0579 (cysK)
    T0131:
    SAT0131_00560
    TCH60:
    HMPREF0772_10005 (cysK)
    TW20:
    SATW20_05810
    USA300_TCH1516:
    USA300HOU_0507 (cysK)
    VC40:
    SAVC_02150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAQKPVDNITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAERE
    N315            MAQKPVDNITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAERE
    NCTC8325        MAQKPVDNITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAERE
    Newman          MAQKPVDNITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAERE
    USA300_FPR3757  MAQKPVDNITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSVKDRIALAMIEKAERE
                    ************************************************************

    COL             GKIKPGDTIVEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPG
    N315            GKIKPGDTIVEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPG
    NCTC8325        GKIKPGDTIVEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPG
    Newman          GKIKPGDTIVEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPG
    USA300_FPR3757  GKIKPGDTIVEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQERRNLLKAYGAELVLTPG
                    ************************************************************

    COL             SEAMKGAIKKAKELKEEHGYFEPQQFENPANPEVHELTTGPELLQQFEGKTIDAFLAGVG
    N315            SEAMKGAIKKAKELKEEHGYFEPQQFENPANPEVHELTTGPELLQQFEGKTIDAFLAGVG
    NCTC8325        SEAMKGAIKKAKELKEEHGYFEPQQFENPANPEVHELTTGPELLQQFEGKTIDAFLAGVG
    Newman          SEAMKGAIKKAKELKEEHGYFEPQQFENPANPEVHELTTGPELLQQFEGKTIDAFLAGVG
    USA300_FPR3757  SEAMKGAIKKAKELKEEHGYFEPQQFENPANPEVHELTTGPELLQQFEGKTIDAFLAGVG
                    ************************************************************

    COL             TGGTLSGVGKVLKKEYPNIEIVAIEPEASPVLSGGEPGPHKLQGLGAGFIPGTLNTEIYD
    N315            TGGTLSGVGKVLKKEYPNIEIVAIEPEASPVLSGGEPGPHKLQGLGAGFIPGTLNTEIYD
    NCTC8325        TGGTLSGVGKVLKKEYPNIEIVAIEPEASPVLSGGEPGPHKLQGLGAGFIPGTLNTEIYD
    Newman          TGGTLSGVGKVLKKEYPNIEIVAIEPEASPVLSGGEPGPHKLQGLGAGFIPGTLNTEIYD
    USA300_FPR3757  TGGTLSGVGKVLKKEYPNIEIVAIEPEASPVLSGGEPGPHKLQGLGAGFIPGTLNTEIYD
                    ************************************************************

    COL             SIIKVGNDTAMEMSRRVAKEEGILAGISSGAAIYAAIQKAKELGKGKTVVTVLPSNGERY
    N315            SIIKVGNDTAMEMSRRVAKEEGILAGISSGAAIYAAIQKAKELGKGKTVVTVLPSNGERY
    NCTC8325        SIIKVGNDTAMEMSRRVAKEEGILAGISSGAAIYAAIQKAKELGKGKTVVTVLPSNGERY
    Newman          SIIKVGNDTAMEMSRRVAKEEGILAGISSGAAIYAAIQKAKELGKGKTVVTVLPSNGERY
    USA300_FPR3757  SIIKVGNDTAMEMSRRVAKEEGILAGISSGAAIYAAIQKAKELGKGKTVVTVLPSNGERY
                    ************************************************************

    COL             LSTPLYSFDD
    N315            LSTPLYSFDD
    NCTC8325        LSTPLYSFDD
    Newman          LSTPLYSFDD
    USA300_FPR3757  LSTPLYSFDD
                    **********