From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002282000
  • symbol?:
  • description?: PLP-dependent aminotransferase family protein

      descriptions from strain specific annotations:

    • PLP-dependent aminotransferase family protein
    • GntR family transcriptional regulator
    • GntR family regulatory protein
    • transcriptional regulator, gntR family protein
    • bacterial regulatory s, gntR family protein
    • putative GntR family transcriptional regulator
    • putative transcriptional regulator ofpyridoxine metabolism
    • regulatory proteins, gntR family protein
    • transcriptional regulator of GntR family
    • transcriptional regulator of pyridoxine metabolism
  • strand?: -
  • coordinates?: 2804109..2805056
  • synteny block?: BlockID0015810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0493
    08BA02176:
    C248_0589
    11819-97:
    MS7_0507
    71193:
    ST398NM01_0593
    ECT-R 2:
    ECTR2_471
    ED133:
    SAOV_0553c
    ED98:
    SAAV_0479
    HO 5096 0412:
    SAEMRSA15_04440
    JH1:
    SaurJH1_0554
    JH9:
    SaurJH9_0540
    JKD6008:
    SAA6008_00524
    JKD6159:
    SAA6159_00471
    LGA251:
    SARLGA251_04520
    M013:
    M013TW_0502
    MRSA252:
    SAR0521
    MSHR1132:
    SAMSHR1132_04620
    MSSA476:
    SAS0475
    Mu3:
    SAHV_0515
    Mu50:
    SAV0518
    MW2:
    MW0473
    RF122:
    SAB0468c
    ST398:
    SAPIG0593
    T0131:
    SAT0131_00567
    TCH60:
    HMPREF0772_12673
    TW20:
    SATW20_05860
    USA300_TCH1516:
    USA300HOU_0510
    VC40:
    SAVC_02175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNTLYHQLYEKLKKQIIEGQFKEGDKFYSKRQLSKHLSISQTTVEHAYQLLLDEGYIYS
    N315            MKNTLYHQLYEKLKKQIIEGQFKEGDKFYSKRQLSKHLSISQTTVEHAYQLLLDEGYIYS
    NCTC8325        MKNTLYHQLYEKLKKQIIEGQFKEGDKFYSKRQLSKHLSISQTTVEHAYQLLLDEGYIYS
    Newman          MKNTLYHQLYEKLKKQIIEGQFKEGDKFYSKRQLSKHLSISQTTVEHAYQLLLDEGYIYS
    USA300_FPR3757  MKNTLYHQLYEKLKKQIIEGQFKEGDKFYSKRQLSKHLSISQTTVEHAYQLLLDEGYIYS
                    ************************************************************

    COL             RPRSGYFVSEIESLTILNNQPIPSLFDDDSYKPKASDEAYDYAFNLDEIDTKHFPIELFR
    N315            RPRSGYFVSEIESLTILNNQPIPSLFDDDSYKPKASDEAYDYAFNLDEIDTKHFPIELFR
    NCTC8325        RPRSGYFVSEIESLTILNNQPIPSLFDDDSYKPKASDEAYDYAFNLDEIDTKHFPIELFR
    Newman          RPRSGYFVSEIESLTILNNQPIPSLFDDDSYKPKASDEAYDYAFNLDEIDTKHFPIELFR
    USA300_FPR3757  RPRSGYFVSEIESLTILNNQPIPSLFDDDSYKPKASDEAYDYAFNLDEIDTKHFPIELFR
                    ************************************************************

    COL             KYSKDLYDTNHLNQLRRGHFQGELHLRFQLAFYLFTNRGVICDPNQIIIGSSTEQLVNQL
    N315            KYSKDLYDTNHLNQLRRGHFQGELHLRFQLAFYLFTNRGVICDPNQIIIGSSTEQLVNQL
    NCTC8325        KYSKDLYDTNHLNQLRRGHFQGELHLRFQLAFYLFTNRGVICDPNQIIIGSSTEQLVNQL
    Newman          KYSKDLYDTNHLNQLRRGHFQGELHLRFQLAFYLFTNRGVICDPNQIIIGSSTEQLVNQL
    USA300_FPR3757  KYSKDLYDTNHLNQLRRGHFQGELHLRFQLAFYLFTNRGVICDPNQIIIGSSTEQLVNQL
                    ************************************************************

    COL             VDLLYTSTFIIEKPSYPPIKNILDKKQVEYEQIEVEDNGINVDEVIKSQKNIVYITPSHQ
    N315            VDLLYTSTFIIEKPSYPPIKNILDKKQVEYEQIEVEDNGINVDEVIKSQKNIVYITPSHQ
    NCTC8325        VDLLYTSTFIIEKPSYPPIKNILDKKQVEYEQIEVEDNGINVDEVIKSQKNIVYITPSHQ
    Newman          VDLLYTSTFIIEKPSYPPIKNILDKKQVEYEQIEVEDNGINVDEVIKSQKNIVYITPSHQ
    USA300_FPR3757  VDLLYTSTFIIEKPSYPPIKNILDKKQVEYEQIEVEDNGINVDEVIKSQKNIVYITPSHQ
                    ************************************************************

    COL             FPTGYVMDLKKRTQLIQWAQEKEERFIIEDDYDSEFRYFGKPIPAIQGLYSRGEKVIYIS
    N315            FPTGYVMDLKKRTQLIQWAQEKEERFIIEDDYDSEFRYFGKPIPAIQGLYSRGEKVIYIS
    NCTC8325        FPTGYVMDLKKRTQLIQWAQEKEERFIIEDDYDSEFRYFGKPIPAIQGLYSRGEKVIYIS
    Newman          FPTGYVMDLKKRTQLIQWAQEKEERFIIEDDYDSEFRYFGKPIPAIQGLYSRGEKVIYIS
    USA300_FPR3757  FPTGYVMDLKKRTQLIQWAQEKEERFIIEDDYDSEFRYFGKPIPAIQGLYSRGEKVIYIS
                    ************************************************************

    COL             TFSKSIFPSCRVAYMVLPYSIMKKYHSQNHIEGNTVPVHMQNLIATFISSGGFERHLNKM
    N315            TFSKSIFPSCRVAYMVLPYSIMKKYHSQNHIEGNTVPVHMQNLIATFISSGGFERHLNKM
    NCTC8325        TFSKSIFPSCRVAYMVLPYSIMKKYHSQNHIEGNTVPVHMQNLIATFISSGGFERHLNKM
    Newman          TFSKSIFPSCRVAYMVLPYSIMKKYHSQNHIEGNTVPVHMQNLIATFISSGGFERHLNKM
    USA300_FPR3757  TFSKSIFPSCRVAYMVLPYSIMKKYHSQNHIEGNTVPVHMQNLIATFISSGGFERHLNKM
                    ************************************************************

    COL             RRIYRRKLTYILKRLKPYKEQLDIQGAETGMHFTITVKNGLTLQECLDRANKVKLKLQVY
    N315            RRIYRRKLTYILKRLKPYKEQLDIQGAETGMHFTITVKNGLTLQECLDRANKVKLKLQVY
    NCTC8325        RRIYRRKLTYILKRLKPYKEQLDIQGAETGMHFTITVKNGLTLQECLDRANKVKLKLQVY
    Newman          RRIYRRKLTYILKRLKPYKEQLDIQGAETGMHFTITVKNGLTLQECLDRANKVKLKLQVY
    USA300_FPR3757  RRIYRRKLTYILKRLKPYKEQLDIQGAETGMHFTITVKNGLTLQECLDRANKVKLKLQVY
                    ************************************************************

    COL             NFDDDQDYKKTPKFILGFGGIDDDALKPHVDALIKSLIIK
    N315            NFDDDQDYKKTPKFILGFGGIDDDALKPHVDALIKSLIIK
    NCTC8325        NFDDDQDYKKTPKFILGFGGIDDDALKPHVDALIKSLIIK
    Newman          NFDDDQDYKKTPKFILGFGGIDDDALKPHVDALIKSLIIK
    USA300_FPR3757  NFDDDQDYKKTPKFILGFGGIDDDALKPHVDALIKSLIIK
                    ****************************************