From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002283000
  • symbol?: pdxS
  • description?: pyridoxal biosynthesis lyase PdxS

      descriptions from strain specific annotations:

    • pyridoxal biosynthesis lyase PdxS
    • pyridoxal 5'-phosphate synthase lyase subunit PdxS
    • Pyridoxine biosynthesis glutamine amidotransferase, synthase subunit
    • pyridoxine biosynthesis protein
    • putative pyridoxine biosynthesis protein
    • pyridoxal 5'-phosphate synthase, synthase subunit Pdx1
  • strand?: +
  • coordinates?: 2805595..2806483
  • synteny block?: BlockID0015820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0494
    08BA02176:
    C248_0590
    11819-97:
    MS7_0508
    71193:
    ST398NM01_0594
    ECT-R 2:
    ECTR2_472
    ED133:
    SAOV_0554
    ED98:
    SAAV_0480
    HO 5096 0412:
    SAEMRSA15_04450
    JH1:
    SaurJH1_0555
    JH9:
    SaurJH9_0541
    JKD6008:
    SAA6008_00525 (pdxS)
    JKD6159:
    SAA6159_00472 (pdxS)
    LGA251:
    SARLGA251_04530
    M013:
    M013TW_0503
    MRSA252:
    SAR0522
    MSHR1132:
    SAMSHR1132_04630
    MSSA476:
    SAS0476
    Mu3:
    SAHV_0516
    Mu50:
    SAV0519
    MW2:
    MW0474
    RF122:
    SAB0469
    ST398:
    SAPIG0594
    T0131:
    SAT0131_00568
    TCH60:
    HMPREF0772_12672
    TW20:
    SATW20_05870
    USA300_TCH1516:
    USA300HOU_0511
    VC40:
    SAVC_02180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKIIGSDRVKRGMAEMQKGGVIMDVVNAEQARIAEEAGAVAVMALERVPSDIRAAGGVA
    N315            MSKIIGSDRVKRGMAEMQKGGVIMDVVNAEQARIAEEAGAVAVMALERVPSDIRAAGGVA
    NCTC8325        MSKIIGSDRVKRGMAEMQKGGVIMDVVNAEQARIAEEAGAVAVMALERVPSDIRAAGGVA
    Newman          MSKIIGSDRVKRGMAEMQKGGVIMDVVNAEQARIAEEAGAVAVMALERVPSDIRAAGGVA
    USA300_FPR3757  MSKIIGSDRVKRGMAEMQKGGVIMDVVNAEQARIAEEAGAVAVMALERVPSDIRAAGGVA
                    ************************************************************

    COL             RMANPKIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDESEVLTPADEEYHLRKD
    N315            RMANPKIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDESEVLTPADEEYHLRKD
    NCTC8325        RMANPKIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDESEVLTPADEEYHLRKD
    Newman          RMANPKIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDESEVLTPADEEYHLRKD
    USA300_FPR3757  RMANPKIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDESEVLTPADEEYHLRKD
                    ************************************************************

    COL             QFTVPFVCGCRNLGEAARRIGEGAAMLRTKGEPGTGNIVEAVRHMRQVNSEVSRLTVMND
    N315            QFTVPFVCGCRNLGEAARRIGEGAAMLRTKGEPGTGNIVEAVRHMRQVNSEVSRLTVMND
    NCTC8325        QFTVPFVCGCRNLGEAARRIGEGAAMLRTKGEPGTGNIVEAVRHMRQVNSEVSRLTVMND
    Newman          QFTVPFVCGCRNLGEAARRIGEGAAMLRTKGEPGTGNIVEAVRHMRQVNSEVSRLTVMND
    USA300_FPR3757  QFTVPFVCGCRNLGEAARRIGEGAAMLRTKGEPGTGNIVEAVRHMRQVNSEVSRLTVMND
                    ************************************************************

    COL             DEIMTFAKDIGAPYEILKQIKDNGRLPVVNFAAGGVATPQDAALMMELGADGVFVGSGIF
    N315            DEIMTFAKDIGAPYEILKQIKDNGRLPVVNFAAGGVATPQDAALMMELGADGVFVGSGIF
    NCTC8325        DEIMTFAKDIGAPYEILKQIKDNGRLPVVNFAAGGVATPQDAALMMELGADGVFVGSGIF
    Newman          DEIMTFAKDIGAPYEILKQIKDNGRLPVVNFAAGGVATPQDAALMMELGADGVFVGSGIF
    USA300_FPR3757  DEIMTFAKDIGAPYEILKQIKDNGRLPVVNFAAGGVATPQDAALMMELGADGVFVGSGIF
                    ************************************************************

    COL             KSEDPEKFAKAIVQATTHYQDYELIGRLASELGTAMKGLDINQLSLEERMQERGW
    N315            KSEDPEKFAKAIVQATTHYQDYELIGRLASELGTAMKGLDINQLSLEERMQERGW
    NCTC8325        KSEDPEKFAKAIVQATTHYQDYELIGRLASELGTAMKGLDINQLSLEERMQERGW
    Newman          KSEDPEKFAKAIVQATTHYQDYELIGRLASELGTAMKGLDINQLSLEERMQERGW
    USA300_FPR3757  KSEDPEKFAKAIVQATTHYQDYELIGRLASELGTAMKGLDINQLSLEERMQERGW
                    *******************************************************