From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002286000
  • symbol?: nupC
  • description?: pyrimidine nucleoside transporter NupC

      descriptions from strain specific annotations:

    • pyrimidine nucleoside transporter NupC
    • pyrimidine nucleoside transport protein
    • nucleoside permease NupC
    • CNT family concentrative nucleoside transporter
    • Na+ dependent nucleoside transporter
    • Na+ dependent nucleoside transporter domain-containing protein
    • Na+ dependent nucleoside transporter family protein
  • strand?: -
  • coordinates?: 2807266..2808480
  • synteny block?: BlockID0015850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0566 (nupC)
    N315:
    SA0479 (nupC)
    NCTC8325:
    Newman:
    NWMN_0483 (nupC)
    USA300_FPR3757:
    04-02981:
    SA2981_0496 (nupC)
    08BA02176:
    C248_0593 (nupC)
    11819-97:
    MS7_0510
    71193:
    ST398NM01_0596
    ECT-R 2:
    ECTR2_474
    ED133:
    SAOV_0556c
    ED98:
    SAAV_0482 (nupC)
    HO 5096 0412:
    SAEMRSA15_04470 (nupC)
    JH1:
    SaurJH1_0557
    JH9:
    SaurJH9_0543
    JKD6008:
    SAA6008_00527 (nupC)
    JKD6159:
    SAA6159_00474 (nupC)
    LGA251:
    SARLGA251_04560 (nupC)
    M013:
    M013TW_0505
    MRSA252:
    SAR0524 (nupC)
    MSHR1132:
    SAMSHR1132_04650
    MSSA476:
    SAS0478
    Mu3:
    SAHV_0518 (nupC)
    Mu50:
    SAV0521 (nupC)
    MW2:
    MW0476 (nupC)
    RF122:
    SAB0471c (nupC)
    ST398:
    SAPIG0596
    T0131:
    SAT0131_00571
    TCH60:
    HMPREF0772_12670 (nupC2)
    TW20:
    SATW20_05900 (nupC)
    USA300_TCH1516:
    USA300HOU_0514 (nupC1)
    VC40:
    SAVC_02190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHILIGIIGIIFFLALAFLFSSDRKNIRWKYVGILLAIQLIFAFILLKTTMGIKVIGGIS
    N315            MHILIGIIGIIFFLALAFLFSSDRKNIRWKYVGILLAIQLIFAFILLKTTMGIKVIGGIS
    NCTC8325        MHILIGIIGIIFFLALAFLFSSDRKNIRWKYVGILLAIQLIFAFILLKTTMGIKVIGGIS
    Newman          MHILIGIIGIIFFLALAFLFSSDRKNIRWKYVGILLAIQLIFAFILLKTTMGIKVIGGIS
    USA300_FPR3757  MHILIGIIGIIFFLALAFLFSSDRKNIRWKYVGILLAIQLIFAFILLKTTMGIKVIGGIS
                    ************************************************************

    COL             NGFNYLLLKAADGVNFVFGGIQYIDPKQPPFFFSVLLPIVFISAIIGILQYTKILPLIIN
    N315            NGFNYLLLKAADGVNFVFGGIQYIDPKQPPFFFSVLLPIVFISAIIGILQYTKILPLIIN
    NCTC8325        NGFNYLLLKAADGVNFVFGGIQYIDPKQPPFFFSVLLPIVFISAIIGILQYTKILPLIIN
    Newman          NGFNYLLLKAADGVNFVFGGIQYIDPKQPPFFFSVLLPIVFISAIIGILQYTKILPLIIN
    USA300_FPR3757  NGFNYLLLKAADGVNFVFGGIQYIDPKQPPFFFSVLLPIVFISAIIGILQYTKILPLIIN
                    ************************************************************

    COL             VLGFLISKINGMGRLESYNAVAAAILGQSEVFISIKKQLPYIPKQRLYTLTASAMSTVSA
    N315            VLGFLISKINGMGRLESYNAVAAAILGQSEVFISIKKQLPYIPKQRLYTLTASAMSTVSA
    NCTC8325        VLGFLISKINGMGRLESYNAVAAAILGQSEVFISIKKQLPYIPKQRLYTLTASAMSTVSA
    Newman          VLGFLISKINGMGRLESYNAVAAAILGQSEVFISIKKQLPYIPKQRLYTLTASAMSTVSA
    USA300_FPR3757  VLGFLISKINGMGRLESYNAVAAAILGQSEVFISIKKQLPYIPKQRLYTLTASAMSTVSA
                    ************************************************************

    COL             SIIGAYFTLIEPKYVVTAVVLNLFGGFIIASIINPYKVNEEDDKLLVEETEERQQSFFEM
    N315            SIIGAYFTLIEPKYVVTAVVLNLFGGFIIASIINPYKVNEEDDKLLVEETEERQQSFFEM
    NCTC8325        SIIGAYFTLIEPKYVVTAVVLNLFGGFIIASIINPYKVNEEDDKLLVEETEERQQSFFEM
    Newman          SIIGAYFTLIEPKYVVTAVVLNLFGGFIIASIINPYKVNEEDDKLLVEETEERQQSFFEM
    USA300_FPR3757  SIIGAYFTLIEPKYVVTAVVLNLFGGFIIASIINPYKVNEEDDKLLVEETEERQQSFFEM
                    ************************************************************

    COL             LGEYILDGFKVAVIVGAMLIGYIAIIALLNGIVSNIFSTVSGGAISWDFQTLIGFVFAPF
    N315            LGEYILDGFKVAVIVGAMLIGYIAIIALLNGIVSNIFSTVSGGAISWDFQTLIGFVFAPF
    NCTC8325        LGEYILDGFKVAVIVGAMLIGYIAIIALLNGIVSNIFSTVSGGAISWDFQTLIGFVFAPF
    Newman          LGEYILDGFKVAVIVGAMLIGYIAIIALLNGIVSNIFSTVSGGAISWDFQTLIGFVFAPF
    USA300_FPR3757  LGEYILDGFKVAVIVGAMLIGYIAIIALLNGIVSNIFSTVSGGAISWDFQTLIGFVFAPF
                    ************************************************************

    COL             AFLVGVPWQDAVQAGSVMATKLLSNEFVAMQALGKLSDLSEHAKGVTSVFLVSFANFSSI
    N315            AFLVGVPWQDAVQAGSVMATKLLSNEFVAMQALGKLSDLSEHAKGVTSVFLVSFANFSSI
    NCTC8325        AFLVGVPWQDAVQAGSVMATKLLSNEFVAMQALGKLSDLSEHAKGVTSVFLVSFANFSSI
    Newman          AFLVGVPWQDAVQAGSVMATKLLSNEFVAMQALGKLSDLSEHAKGVTSVFLVSFANFSSI
    USA300_FPR3757  AFLVGVPWQDAVQAGSVMATKLLSNEFVAMQALGKLSDLSEHAKGVTSVFLVSFANFSSI
                    ************************************************************

    COL             GIISGAIKSLNDKKGDTVARFGLKLLFGATLVSFISAAIAGFFI
    N315            GIISGAIKSLNDKKGDTVARFGLKLLFGATLVSFISAAIAGFFI
    NCTC8325        GIISGAIKSLNDKKGDTVARFGLKLLFGATLVSFISAAIAGFFI
    Newman          GIISGAIKSLNDKKGDTVARFGLKLLFGATLVSFISAAIAGFFI
    USA300_FPR3757  GIISGAIKSLNDKKGDTVARFGLKLLFGATLVSFISAAIAGFFI
                    ********************************************