From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002292000
  • symbol?: radA
  • description?: DNA repair protein RadA

      descriptions from strain specific annotations:

    • DNA repair protein RadA
    • putative DNA repair protein
  • strand?: +
  • coordinates?: 2813660..2815024
  • synteny block?: BlockID0015910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0572 (radA)
    N315:
    SA0484 (radA)
    NCTC8325:
    Newman:
    NWMN_0488 (radA)
    USA300_FPR3757:
    04-02981:
    SA2981_0501 (radA)
    08BA02176:
    C248_0598 (radA)
    11819-97:
    MS7_0515 (radA)
    71193:
    ST398NM01_0601
    ECT-R 2:
    ECTR2_479 (radA)
    ED133:
    SAOV_0561
    ED98:
    SAAV_0487 (radA)
    HO 5096 0412:
    SAEMRSA15_04520 (radA)
    JH1:
    SaurJH1_0562
    JH9:
    SaurJH9_0548
    JKD6008:
    SAA6008_00532 (radA)
    JKD6159:
    SAA6159_00479 (radA)
    LGA251:
    SARLGA251_04610 (radA)
    M013:
    M013TW_0510
    MRSA252:
    SAR0529 (radA)
    MSHR1132:
    SAMSHR1132_04700
    MSSA476:
    SAS0483
    Mu3:
    SAHV_0523 (radA)
    Mu50:
    SAV0526 (radA)
    MW2:
    MW0481 (radA)
    RF122:
    SAB0476 (radA)
    ST398:
    SAPIG0601 (radA)
    T0131:
    SAT0131_00578
    TCH60:
    HMPREF0772_12665 (radA)
    TW20:
    SATW20_05950 (radA)
    USA300_TCH1516:
    USA300HOU_0519 (radA)
    VC40:
    SAVC_02215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKKKVIFECMACGYQSPKWMGKCPNCGAWNQMEEIVEKAANPKHGVKTKELAGKVQKLN
    N315            MAKKKVIFECMACGYQSPKWMGKCPNCGAWNQMEEIVEKAANPKHGVKTKELAGKVQKLN
    NCTC8325        MAKKKVIFECMACGYQSPKWMGKCPNCGAWNQMEEIVEKAANPKHGVKTKELAGKVQKLN
    Newman          MAKKKVIFECMACGYQSPKWMGKCPNCGAWNQMEEIVEKAANPKHGVKTKELAGKVQKLN
    USA300_FPR3757  MAKKKVIFECMACGYQSPKWMGKCPNCGAWNQMEEIVEKAANPKHGVKTKELAGKVQKLN
                    ************************************************************

    COL             SIKHETTPRVLTDSAEFNRVLGGGIVSGSLVLIGGDPGIGKSTLLLQICASLSQKKKVLY
    N315            SIKHETTPRVLTDSAEFNRVLGGGIVSGSLVLIGGDPGIGKSTLLLQICASLSQKKKVLY
    NCTC8325        SIKHETTPRVLTDSAEFNRVLGGGIVSGSLVLIGGDPGIGKSTLLLQICASLSQKKKVLY
    Newman          SIKHETTPRVLTDSAEFNRVLGGGIVSGSLVLIGGDPGIGKSTLLLQICASLSQKKKVLY
    USA300_FPR3757  SIKHETTPRVLTDSAEFNRVLGGGIVSGSLVLIGGDPGIGKSTLLLQICASLSQKKKVLY
                    ************************************************************

    COL             ITGEESLSQTKLRAERLDEDSSELQVLAETDLEVIYQTVKEEQPDLLVVDSIQTIYHPEI
    N315            ITGEESLSQTKLRAERLDEDSSELQVLAETDLEVIYQTVKEEQPDLLVVDSIQTIYHPEI
    NCTC8325        ITGEESLSQTKLRAERLDEDSSELQVLAETDLEVIYQTVKEEQPDLLVVDSIQTIYHPEI
    Newman          ITGEESLSQTKLRAERLDEDSSELQVLAETDLEVIYQTVKEEQPDLLVVDSIQTIYHPEI
    USA300_FPR3757  ITGEESLSQTKLRAERLDEDSSELQVLAETDLEVIYQTVKEEQPDLLVVDSIQTIYHPEI
                    ************************************************************

    COL             SSAPGSVSQVRESTQSLMNIAKQMNIATFIVGHVTKEGQIAGPRLLEHMVDTVLYFEGDE
    N315            SSAPGSVSQVRESTQSLMNIAKQMNIATFIVGHVTKEGQIAGPRLLEHMVDTVLYFEGDE
    NCTC8325        SSAPGSVSQVRESTQSLMNIAKQMNIATFIVGHVTKEGQIAGPRLLEHMVDTVLYFEGDE
    Newman          SSAPGSVSQVRESTQSLMNIAKQMNIATFIVGHVTKEGQIAGPRLLEHMVDTVLYFEGDE
    USA300_FPR3757  SSAPGSVSQVRESTQSLMNIAKQMNIATFIVGHVTKEGQIAGPRLLEHMVDTVLYFEGDE
                    ************************************************************

    COL             HHAYRILRAVKNRFGSTNEMGIFEMKQSGLKGVNNPSEMFLEERSTNVPGSTIVATMEGT
    N315            HHAYRILRAVKNRFGSTNEMGIFEMKQSGLKGVNNPSEMFLEERSTNVPGSTIVATMEGT
    NCTC8325        HHAYRILRAVKNRFGSTNEMGIFEMKQSGLKGVNNPSEMFLEERSTNVPGSTIVATMEGT
    Newman          HHAYRILRAVKNRFGSTNEMGIFEMKQSGLKGVNNPSEMFLEERSTNVPGSTIVATMEGT
    USA300_FPR3757  HHAYRILRAVKNRFGSTNEMGIFEMKQSGLKGVNNPSEMFLEERSTNVPGSTIVATMEGT
                    ************************************************************

    COL             RPLLIEVQALVTPTTFNNPRRMATGIDHNRLSLLMAVLEKKENYLLQQQDAYIKVAGGVK
    N315            RPLLIEVQALVTPTTFNNPRRMATGIDHNRLSLLMAVLEKKENYLLQQQDAYIKVAGGVK
    NCTC8325        RPLLIEVQALVTPTTFNNPRRMATGIDHNRLSLLMAVLEKKENYLLQQQDAYIKVAGGVK
    Newman          RPLLIEVQALVTPTTFNNPRRMATGIDHNRLSLLMAVLEKKENYLLQQQDAYIKVAGGVK
    USA300_FPR3757  RPLLIEVQALVTPTTFNNPRRMATGIDHNRLSLLMAVLEKKENYLLQQQDAYIKVAGGVK
                    ************************************************************

    COL             LTEPAVDLSVIVATASSFKDKAVDGLDCYIGEVGLTGEVRRVSRIEQRVQEAAKLGFKRV
    N315            LTEPAVDLSVIVATASSFKDKAVDGLDCYIGEVGLTGEVRRVSRIEQRVQEAAKLGFKRV
    NCTC8325        LTEPAVDLSVIVATASSFKDKAVDGLDCYIGEVGLTGEVRRVSRIEQRVQEAAKLGFKRV
    Newman          LTEPAVDLSVIVATASSFKDKAVDGLDCYIGEVGLTGEVRRVSRIEQRVQEAAKLGFKRV
    USA300_FPR3757  LTEPAVDLSVIVATASSFKDKAVDGLDCYIGEVGLTGEVRRVSRIEQRVQEAAKLGFKRV
                    ************************************************************

    COL             IIPKNNIGGWTYPEGIQVIGVTTVHEVLSFALHS
    N315            IIPKNNIGGWTYPEGIQVIGVTTVHEALSFALHS
    NCTC8325        IIPKNNIGGWTYPEGIQVIGVTTVHEVLSFALHS
    Newman          IIPKNNIGGWTYPEGIQVIGVTTVHEVLSFALHS
    USA300_FPR3757  IIPKNNIGGWTYPEGIQVIGVTTVHEVLSFALHS
                    **************************.*******