From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002293000
  • symbol?:
  • description?: PIN/TRAM domain-containing protein

      descriptions from strain specific annotations:

    • PIN/TRAM domain-containing protein
    • PilT domain-containing protein
    • Integral membrane protein (PIN domain superfamily)
    • membrane associated protein
    • Membrane-associated protein containing a PilT-like ATPase N-terminal domain
    • Pili retraction protein pilT
    • PilT protein domain-containing protein
    • PIN domain-containing protein
    • PIN domain protein
  • strand?: +
  • coordinates?: 2815049..2816122
  • synteny block?: BlockID0015920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0502 (pilT)
    08BA02176:
    C248_0599
    11819-97:
    MS7_0516
    71193:
    ST398NM01_0602
    ECT-R 2:
    ECTR2_480
    ED133:
    SAOV_0562
    ED98:
    SAAV_0488
    HO 5096 0412:
    SAEMRSA15_04530
    JH1:
    SaurJH1_0563
    JH9:
    SaurJH9_0549
    JKD6008:
    SAA6008_00533
    JKD6159:
    SAA6159_00480
    LGA251:
    SARLGA251_04620
    M013:
    M013TW_0511
    MRSA252:
    SAR0530
    MSHR1132:
    SAMSHR1132_04710
    MSSA476:
    SAS0484
    Mu3:
    SAHV_0524
    Mu50:
    SAV0527
    MW2:
    MW0482
    RF122:
    SAB0477
    ST398:
    SAPIG0602
    T0131:
    SAT0131_00579 (splC)
    TCH60:
    HMPREF0772_12664
    TW20:
    SATW20_05960
    USA300_TCH1516:
    USA300HOU_0520
    VC40:
    SAVC_02220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIVKLMVIIIYLIIGSALGIIIIPEIANDLGLQNSSFLKNHYVDGIIGSIFMFLIFGVF
    N315            MNIVKLMVIIIYLIIGSALGIIIIPEIANDLGLQNSSFLKNHYVDGIIGSIFMFLIFGVF
    NCTC8325        ------MVIIIYLIIGSALGIIIIPEIANDLGLQNSSFLKNHYVDGIIGSIFMFLIFGVF
    Newman          MNIVKLMVIIIYLIIGSALGIIIIPEIANDLGLQNSSFLKNHYVDGIIGSIFMFLIFGVF
    USA300_FPR3757  ------MVIIIYLIIGSALGIIIIPEIANDLGLQNSSFLKNHYVDGIIGSIFMFLIFGVF
                          ******************************************************

    COL             IRRVTNAIKGLEHFIMRRSAVEILFATIGLIIGLLISVMVSFILESIGNSIFNHFIPVII
    N315            IRRVTNAIKGLEHFIMRRSAVEILFATIGLIIGLLISVMVSFILESIGNSIFNHFIPVII
    NCTC8325        IRRVTNAIKGLEHFIMRRSAVEILFATIGLIIGLLISVMVSFILESIGNSIFNHFIPVII
    Newman          IRRVTNAIKGLEHFIMRRSAVEILFATIGLIIGLLISVMVSFILESIGNSIFNHFIPVII
    USA300_FPR3757  IRRVTNAIKGLEHFIMRRSAVEILFATIGLIIGLLISVMVSFILESIGNSIFNHFIPVII
                    ************************************************************

    COL             TILLCYFGFQFGLKKRDEMLMFLPENIARSMSQHTKSATPKIIDTSAIIDGRILEVIRCG
    N315            TILLCYFGFQFGLKKRDEMLMFLPENIARSMSQHTKSATPKIIDTSAIIDGRILEVIRCG
    NCTC8325        TILLCYFGFQFGLKKRDEMLMFLPENIARSMSQHTKSATPKIIDTSAIIDGRILEVIRCG
    Newman          TILLCYFGFQFGLKKRDEMLMFLPENIARSMSQHTKSATPKIIDTSAIIDGRILEVIRCG
    USA300_FPR3757  TILLCYFGFQFGLKKRDEMLMFLPENIARSMSQHTKSATPKIIDTSAIIDGRILEVIRCG
                    ************************************************************

    COL             FIDGNILIPQGVINELQIVADSNDSVKREKGKRGLDILNELYDLDYPTKVIHPTKTHSDI
    N315            FIDGNILIPQGVINELQIVADSNDSVKREKGKRGLDILNELYDLDYPTKVIHPTKTHSDI
    NCTC8325        FIDGNILIPQGVINELQIVADSNDSVKREKGKRGLDILNELYDLDYPTKVIHPTKTHSDI
    Newman          FIDGNILIPQGVINELQIVADSNDSVKREKGKRGLDILNELYDLDYPTKVIHPTKTHSDI
    USA300_FPR3757  FIDGNILIPQGVINELQIVADSNDSVKREKGKRGLDILNELYDLDYPTKVIHPTKTHSDI
                    ************************************************************

    COL             DTMLLKLAKQYHASIITTDFNLNKVCHVHGIKALNVNDLSEAIKPNVHQGDQLHILLTKM
    N315            DTMLLKLAKQYHASIITTDFNLNKVCHVHGIKALNVNDLSEAIKPNVHQGDQLHILLTKM
    NCTC8325        DTMLLKLAKQYHASIITTDFNLNKVCHVHGIKALNVNDLSEAIKPNVHQGDQLHILLTKM
    Newman          DTMLLKLAKQYHASIITTDFNLNKVCHVHGIKALNVNDLSEAIKPNVHQGDQLHILLTKM
    USA300_FPR3757  DTMLLKLAKQYHASIITTDFNLNKVCHVHGIKALNVNDLSEAIKPNVHQGDQLHILLTKM
                    ************************************************************

    COL             GKEPGQAVGYLDDGTMVVVDNAKNLIGSHVNLEVVSLLQTSSGRIVFAKKIEDTVSL
    N315            GKEPGQAVGYLDDGTMVVVDNAKNLIGSHVNLEVVSLLQTSSGRIVFAKKIEDTVSL
    NCTC8325        GKEPGQAVGYLDDGTMVVVDNAKNLIGSHVNLEVVSLLQTSSGRIVFAKKIEDTVSL
    Newman          GKEPGQAVGYLDDGTMVVVDNAKNLIGSHVNLEVVSLLQTSSGRIVFAKKIEDTVSL
    USA300_FPR3757  GKEPGQAVGYLDDGTMVVVDNAKNLIGSHVNLEVVSLLQTSSGRIVFAKKIEDTVSL
                    *********************************************************