From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002305000
  • symbol?: nusG
  • description?: transcription antitermination protein

      descriptions from strain specific annotations:

    • transcription antitermination protein
    • transcription termination/antitermination protein NusG
    • Transcription antitermination protein NusG
    • transcription termination/antitermination factor NusG
  • strand?: +
  • coordinates?: 2823453..2824001
  • synteny block?: BlockID0016040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0582 (nusG)
    N315:
    SA0494 (nusG)
    NCTC8325:
    Newman:
    NWMN_0498 (nusG)
    USA300_FPR3757:
    04-02981:
    SA2981_0512 (nusG)
    08BA02176:
    C248_0610 (nusG)
    11819-97:
    MS7_0526 (nusG)
    71193:
    ST398NM01_0611
    ECT-R 2:
    ECTR2_490 (nusG)
    ED133:
    SAOV_0571
    ED98:
    SAAV_0498 (nusG)
    HO 5096 0412:
    SAEMRSA15_04630 (nusG)
    JH1:
    SaurJH1_0573
    JH9:
    SaurJH9_0559
    JKD6008:
    SAA6008_00542 (nusG)
    JKD6159:
    SAA6159_00489 (nusG)
    LGA251:
    SARLGA251_04720 (nusG)
    M013:
    M013TW_0521
    MRSA252:
    SAR0540 (nusG)
    MSHR1132:
    SAMSHR1132_04800
    MSSA476:
    SAS0494
    Mu3:
    SAHV_0533 (nusG)
    Mu50:
    SAV0535 (nusG)
    MW2:
    MW0491 (nusG)
    RF122:
    SAB0487 (nusG)
    ST398:
    SAPIG0611 (nusG)
    T0131:
    SAT0131_00588 (bsaC)
    TCH60:
    HMPREF0772_12653 (nusG)
    TW20:
    SATW20_06060 (nusG)
    USA300_TCH1516:
    USA300HOU_0530 (nusG)
    VC40:
    SAVC_02270

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVIPEEEETQVKDGKAKT
    N315            MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVIPEEEETQVKDGKAKT
    NCTC8325        MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVIPEEEETQVKDGKAKT
    Newman          MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVIPEEEETQVKDGKAKT
    USA300_FPR3757  MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVIPEEEETQVKDGKAKT
                    ************************************************************

    COL             TVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPNPLLPEEVRFILKQMGL
    N315            TVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPNPLLPEEVRFILKQMGL
    NCTC8325        TVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPNPLLPEEVRFILKQMGL
    Newman          TVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPNPLLPEEVRFILKQMGL
    USA300_FPR3757  TVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPNPLLPEEVRFILKQMGL
                    ************************************************************

    COL             KEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLVDMFGRETPVEVEFDQIE
    N315            KEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLVDMFGRETPVEVEFDQIE
    NCTC8325        KEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLVDMFGRETPVEVEFDQIE
    Newman          KEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLVDMFGRETPVEVEFDQIE
    USA300_FPR3757  KEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLVDMFGRETPVEVEFDQIE
                    ************************************************************

    COL             KL
    N315            KL
    NCTC8325        KL
    Newman          KL
    USA300_FPR3757  KL
                    **