From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0498 [new locus tag: NWMN_RS02905 ]
  • pan locus tag?: SAUPAN002305000
  • symbol: nusG
  • pan gene symbol?: nusG
  • synonym:
  • product: transcription antitermination protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0498 [new locus tag: NWMN_RS02905 ]
  • symbol: nusG
  • product: transcription antitermination protein
  • replicon: chromosome
  • strand: +
  • coordinates: 571845..572393
  • length: 549
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGTCTGAAGAAGTTGGCGCAAAGCGTTGGTATGCAGTGCATACATATTCTGGATATGAA
    AATAAAGTTAAAAAGAATTTAGAAAAAAGAGTAGAATCTATGAATATGACTGAACAAATC
    TTTAGAGTAGTCATACCGGAAGAAGAAGAAACTCAAGTAAAAGATGGCAAAGCTAAAACG
    ACTGTTAAAAAAACATTCCCTGGATATGTTTTAGTGGAATTAATCATGACAGATGAATCA
    TGGTATGTGGTAAGAAATACACCAGGCGTTACTGGTTTTGTAGGTTCTGCAGGTGCAGGG
    TCTAAGCCAAATCCATTGTTACCAGAAGAAGTTCGCTTCATCTTAAAACAAATGGGTCTT
    AAAGAAAAGACTATCGATGTTGAACTCGAAGTTGGCGAGCAAGTTCGTATTAAATCAGGT
    CCATTTGCGAATCAAGTTGGTGAAGTTCAAGAAATTGAAACAGATAAGTTTAAGCTAACA
    GTATTAGTAGATATGTTTGGCCGAGAAACACCAGTAGAAGTTGAATTCGATCAAATAGAA
    AAGCTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    549

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0498 [new locus tag: NWMN_RS02905 ]
  • symbol: NusG
  • description: transcription antitermination protein
  • length: 182
  • theoretical pI: 4.78638
  • theoretical MW: 20663.5
  • GRAVY: -0.423626

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionTranscription factorstranscription termination/antitermination factor NusG (TIGR00922; HMM-score: 203.6)
    NusG family protein (TIGR01956; HMM-score: 106.4)
    Genetic information processingTranscriptionTranscription factorstranscription elongation factor/antiterminator RfaH (TIGR01955; HMM-score: 61.1)
    transcription elongation factor Spt5 (TIGR00405; HMM-score: 27)
  • TheSEED:  
    RNA MetabolismTranscriptionTranscription factors bacterial Transcription antitermination protein NusG 
  • PFAM:
    NusG-like (CL0439) NusG; Transcription termination factor nusG (PF02357; HMM-score: 96.1)
    KOW (CL0107) KOW; KOW motif (PF00467; HMM-score: 29)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.133
    • Ymax_pos: 59
    • Cmax: 0.127
    • Cmax_pos: 59
    • Smax: 0.178
    • Smax_pos: 53
    • Smean: 0.094
    • D: 0.118
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVIPEEEETQVKDGKAKTTVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPNPLLPEEVRFILKQMGLKEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLVDMFGRETPVEVEFDQIEKL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]