From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002318000
  • symbol?: rpsG
  • description?: 30S ribosomal protein S7

      descriptions from strain specific annotations:

    • 30S ribosomal protein S7
    • 30S ribosomalprotein S7p (S5e)
  • strand?: +
  • coordinates?: 2835984..2836455
  • synteny block?: BlockID0016170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0592 (rpsG)
    N315:
    SA0504 (rpsG)
    NCTC8325:
    Newman:
    NWMN_0508 (rpsG)
    USA300_FPR3757:
    04-02981:
    SA2981_0523 (rpsG)
    08BA02176:
    C248_0621 (rpsG)
    11819-97:
    MS7_0536 (rpsG)
    71193:
    ST398NM01_0621
    ECT-R 2:
    ECTR2_500 (rpsG)
    ED133:
    SAOV_0581 (rpsG)
    ED98:
    SAAV_0509 (rpsG)
    HO 5096 0412:
    SAEMRSA15_04730 (rpsG)
    JH1:
    SaurJH1_0583
    JH9:
    SaurJH9_0569
    JKD6008:
    SAA6008_00552 (rpsG)
    JKD6159:
    SAA6159_00500 (rpsG)
    LGA251:
    SARLGA251_04820 (rpsG)
    M013:
    M013TW_0533
    MRSA252:
    SAR0551 (rpsG)
    MSHR1132:
    SAMSHR1132_04900
    MSSA476:
    SAS0504
    Mu3:
    SAHV_0544 (rpsG)
    Mu50:
    SAV0546 (rpsG)
    MW2:
    MW0501 (rpsG)
    RF122:
    SAB0497 (rpsG)
    ST398:
    SAPIG0621 (rpsG)
    T0131:
    SAT0131_00599 (hemH)
    TCH60:
    HMPREF0772_12643 (rpsG)
    TW20:
    SATW20_06160 (rpsG)
    USA300_TCH1516:
    USA300HOU_0540 (rpsG)
    VC40:
    SAVC_02320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGRDALE
    N315            MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGRDALE
    NCTC8325        MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGRDALE
    Newman          MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGRDALE
    USA300_FPR3757  ------------------------------MLDGKRGTAQRILYSAFDLVEQRSGRDALE
                                                  ******************************

    COL             VFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRL
    N315            VFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRL
    NCTC8325        VFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRL
    Newman          VFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRL
    USA300_FPR3757  VFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRL
                    ************************************************************

    COL             ANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW
    N315            ANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW
    NCTC8325        ANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW
    Newman          ANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW
    USA300_FPR3757  ANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW
                    ************************************