From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002323000
  • symbol?: hchA
  • description?: chaperone protein HchA

      descriptions from strain specific annotations:

    • chaperone protein HchA
    • Molecular chaperone Hsp31 and glyoxalase 3
    • chaperone protein hchA (Hsp31) (EcHsp31)
    • chaperone HchA
    • DJ-1/PfpI family protein
    • glyoxalase III
    • ThiJ/PfpI family protein
  • strand?: +
  • coordinates?: 2843253..2844131
  • synteny block?: BlockID0016220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0528
    08BA02176:
    C248_0626
    11819-97:
    MS7_0541
    71193:
    ST398NM01_0626
    ECT-R 2:
    ECTR2_505
    ED133:
    SAOV_0586
    ED98:
    SAAV_0514
    HO 5096 0412:
    SAEMRSA15_04780
    JH1:
    SaurJH1_0588
    JH9:
    SaurJH9_0574
    JKD6008:
    SAA6008_00557
    JKD6159:
    SAA6159_00505
    LGA251:
    SARLGA251_04870
    M013:
    M013TW_0538
    MRSA252:
    SAR0556
    MSHR1132:
    SAMSHR1132_04950
    MSSA476:
    SAS0509
    Mu3:
    SAHV_0549
    Mu50:
    SAV0551
    MW2:
    MW0506
    RF122:
    SAB0502
    ST398:
    SAPIG0626
    T0131:
    SAT0131_00604
    TCH60:
    HMPREF0772_12638 (hchA)
    TW20:
    SATW20_06210
    USA300_TCH1516:
    USA300HOU_0544
    VC40:
    SAVC_02345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQDVNELSKQPTPDKAEDNAFFPSPYSLSQYTAPKTDFDGVEHKGAYKDGKWKVLMIAA
    N315            MSQDVNELSKQPTPDKAEDNAFFPSPYSLSQYTAPKTDFDGVEHKGAYKDGKWKVLMIAA
    NCTC8325        MSQDVNELSKQPTPDKAEDNAFFPSPYSLSQYTAPKTDFDGVEHKGAYKDGKWKVLMIAA
    Newman          MSQDVNELSKQPTPDKAEDNAFFPSPYSLSQYTAPKTDFDGVEHKGAYKDGKWKVLMIAA
    USA300_FPR3757  MSQDVNELSKQPTPDKAEDNAFFPSPYSLSQYTAPKTDFDGVEHKGAYKDGKWKVLMIAA
                    ************************************************************

    COL             EERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVATLSGYPVKLELWAMPTEDEAV
    N315            EERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVATLSGYPVKLELWAMPTEDEAV
    NCTC8325        EERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVATLSGYPVKLELWAMPTEDEAV
    Newman          EERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVATLSGYPVKLELWAMPTEDEAV
    USA300_FPR3757  EERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVATLSGYPVKLELWAMPTEDEAV
                    ************************************************************

    COL             ISTYNKLKEKLKQPKKLADVIKNELGPDSDYLSVFIPGGHAAVVGISESEDVQQTLDWAL
    N315            ISTYNKLKEKLKQPKKLADVIKNELGPDSDYLSVFIPGGHAAVVGISESEDVQQTLDWAL
    NCTC8325        ISTYNKLKEKLKQPKKLADVIKNELGPDSDYLSVFIPGGHAAVVGISESEDVQQTLDWAL
    Newman          ISTYNKLKEKLKQPKKLADVIKNELGPDSDYLSVFIPGGHAAVVGISESEDVQQTLDWAL
    USA300_FPR3757  ISTYNKLKEKLKQPKKLADVIKNELGPDSDYLSVFIPGGHAAVVGISESEDVQQTLDWAL
                    ************************************************************

    COL             DNDRFIVTLCHGPAALLSAGLNREKSPLEGYSVCVFPDSLDEGANIEIGYLPGRLKWLVA
    N315            DNDRFIVTLCHGPAALLSAGLNREKSPLEGYSVCVFPDSLDEGANIEIGYLPGRLKWLVA
    NCTC8325        DNDRFIVTLCHGPAALLSAGLNREKSPLEGYSVCVFPDSLDEGANIEIGYLPGRLKWLVA
    Newman          DNDRFIVTLCHGPAALLSAGINREKSPLEGYSVCVFPDSLDEGANIEIGYLPGRLKWLVA
    USA300_FPR3757  DNDRFIVTLCHGPAALLSAGLNREKSPLEGYSVCVFPDSLDEGANIEIGYLPGRLKWLVA
                    ********************:***************************************

    COL             DLLTKQGLKVVNDDMTGRTLKDRKLLTGDSPLASNELGKLAVNEMLNAIQNK
    N315            DLLTKQGLKVVNDDMTGRTLKDRKLLTGDSPLASNELGKLAVNEMLNAIQNK
    NCTC8325        DLLTKQGLKVVNDDMTGRTLKDRKLLTGDSPLASNELGKLAVNEMLNAIQNK
    Newman          DLLTKQGLKVVNDDMTGRTLKDRKLLTGDSPLASNELGKLAVNEMLNAIQNK
    USA300_FPR3757  DLLTKQGLKVVNDDMTGRTLKDRKLLTGDSPLASNELGKLAVNEMLNAIQNK
                    ****************************************************