From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002324000
  • symbol?: araB
  • description?: ribulokinase

      descriptions from strain specific annotations:

    • ribulokinase
    • L-ribulokinase, putative
    • putative L-ribulokinase
    • putative sugar kinase
    • sugar kinase
  • strand?: +
  • coordinates?: 2844289..2845926
  • synteny block?: BlockID0016230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0510 (araB)
    NCTC8325:
    Newman:
    NWMN_0514 (araB)
    USA300_FPR3757:
    04-02981:
    SA2981_0529 (araB)
    08BA02176:
    C248_0627
    11819-97:
    MS7_0542 (araB)
    71193:
    ST398NM01_0627
    ECT-R 2:
    ECTR2_506
    ED133:
    SAOV_0587
    ED98:
    SAAV_0515
    HO 5096 0412:
    SAEMRSA15_04790
    JH1:
    SaurJH1_0589
    JH9:
    SaurJH9_0575
    JKD6008:
    SAA6008_00558 (araB)
    JKD6159:
    SAA6159_00506 (araB)
    LGA251:
    SARLGA251_04880
    M013:
    M013TW_0539
    MRSA252:
    SAR0557
    MSHR1132:
    SAMSHR1132_04960
    MSSA476:
    SAS0510
    Mu3:
    SAHV_0550 (araB)
    Mu50:
    SAV0552 (araB)
    MW2:
    MW0507 (araB)
    RF122:
    SAB0503
    ST398:
    SAPIG0627
    T0131:
    SAT0131_00605
    TCH60:
    HMPREF0772_12637 (araB)
    TW20:
    SATW20_06220
    USA300_TCH1516:
    USA300HOU_0545 (araB)
    VC40:
    SAVC_02350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSYSIGIDYGTASGRVFLINTTNGQVVSKFVKPYTHGVIESELNGLKIPHTYALQNSNDY
    N315            MSYSIGIDYGTASGRVFLINTTNGQVVSKFVKPYTHGVIESELNGLKIPHTYALQNSNDY
    NCTC8325        MSYSIGIDYGTASGRVFLINTTNGQVVSKFVKPYTHGVIESELNGLKIPHTYALQNSNDY
    Newman          MSYSIGIDYGTASGRVFLINTTNGQVVSKFVKPYTHGVIESELNGLKIPHTYALQNSNDY
    USA300_FPR3757  MSYSIGIDYGTASGRVFLINTTNGQVVSKFVKPYTHGVIESELNGLKIPHTYALQNSNDY
                    ************************************************************

    COL             LEIMEEGISYIVRESKIDPDNIVGIGIDFTSSTIIFTDENLNPVHNLKQFKNNPHAYVKL
    N315            LEIMEEGISYIVRESKIDPVNIVGIGIDFTSSTIIFTDENLNPVHNLKQFKNNPHAYVKL
    NCTC8325        LEIMEEGISYIVRESKIDPDNIVGIGIDFTSSTIIFTDENLNPVHNLKQFKNNPHAYVKL
    Newman          LEIMEEGISYIVRESKIDPDNIVGIGIDFTSSTIIFTDENLNPVHNLKQFKNNPHAYVKL
    USA300_FPR3757  LEIMEEGISYIVRESKIDPDNIVGIGIDFTSSTIIFTDENLNPVHNLKQFKNNPHAYVKL
                    ******************* ****************************************

    COL             WKHHGAYKEAEKLYQTAIENNNKWLGHYGYNVSSEWMIPKIMEVMNRAPEIMEKTAYIME
    N315            WKHHGAYKEAEKLYQTAIENNNKWLGHYGYNVSSEWMIPKIMEVMNRAPEIMEKTAYIME
    NCTC8325        WKHHGAYKEAEKLYQTAIENNNKWLGHYGYNVSSEWMIPKIMEVMNRAPEIMEKTAYIME
    Newman          WKHHGAYKEAEKLYQTAIENNNKWLGHYGYNVSSEWMIPKIMEVMNRAPEIMEKTAYIME
    USA300_FPR3757  WKHHGAYKEAEKLYQTAIENNNKWLGHYGYNVSSEWMIPKIMEVMNRAPEIMEKTAYIME
                    ************************************************************

    COL             AGDWIVNKLTNKNVRSNCGLGFKAFWEEETGFHYDLFDKIDPKLSKVIQDKVSAPVVNIG
    N315            AGDWIVNKLTNKNVRSNCGLGFKAFWEEETGFHYDLFDKIDPKLSKVIQDKVSAPVVNIG
    NCTC8325        AGDWIVNKLTNKNVRSNCGLGFKAFWEEETGFHYDLFDKIDPKLSKVIQDKVSAPVVNIG
    Newman          AGDWIVNKLTNKNVRSNCGLGFKAFWEEETGFHYDLFDKIDPKLSKVIQDKVSAPVVNIG
    USA300_FPR3757  AGDWIVNKLTNKNVRSNCGLGFKAFWEEETGFHYDLFDKIDPKLSKVIQDKVSAPVVNIG
                    ************************************************************

    COL             EAVGKLDDKMAQKLGLSKETMVSPFIIDAHASLLGIGSEKDKEMTMVMGTSTCHLMLNEK
    N315            EVVGKLDDKMAQKLGLSKETMVSPFIIDAHASLLGIGSEKDKEMTMVMGTSTCHLMLNEK
    NCTC8325        EAVGKLDDKMAQKLGLSKETMVSPFIIDAHASLLGIGSEKDKEMTMVMGTSTCHLMLNEK
    Newman          EAVGKLDDKMAQKLGLSKETMVSPFIIDAHASLLGIGSEKDKEMTMVMGTSTCHLMLNEK
    USA300_FPR3757  EAVGKLDDKMAQKLGLSKETMVSPFIIDAHASLLGIGSEKDKEMTMVMGTSTCHLMLNEK
                    *.**********************************************************

    COL             QHQVPGISGSVKGAIIPELFAYEAGQSAVGDLFEYVAKQAPKSYVDEAENRNMTVFELMN
    N315            QHQVPGISGSVKGAIIPELFAYEAGQSAVGDLFEYVAKQAPKSYVDEAANRNMTVFELMN
    NCTC8325        QHQVPGISGSVKGAIIPELFAYEAGQSAVGDLFEYVAKQAPKSYVDEAENRNMTVFELMN
    Newman          QHQVPGISGSVKGAIIPELFAYEAGQSAVGDLFEYVAKQAPKSYVDEAENRNMTVFELMN
    USA300_FPR3757  QHQVPGISGSVKGAIIPELFAYEAGQSAVGDLFEYVAKQAPKSYVDEAENRNMTVFELMN
                    ************************************************ ***********

    COL             EKIKHQMPGESGLIALDWHNGNRSVLSDSNLTGCIFGLTLQTKHEDIYRAYLEATAFGTK
    N315            EKIKHQMPGESGLIALDWHNGNRSVLSDSNLTGCIFGLTLQTKHEDIYRAYLEATAFGTK
    NCTC8325        EKIKHQMPGESGLIALDWHNGNRSVLSDSNLTGCIFGLTLQTKHEDIYRAYLEATAFGTK
    Newman          EKIKHQMPGESGLIALDWHNGNRSVLSDSNLTGCIFGLTLQTKHEDIYRAYLEATAFGTK
    USA300_FPR3757  EKIKHQMPGESGLIALDWHNGNRSVLSDSNLTGCIFGLTLQTKHEDIYRAYLEATAFGTK
                    ************************************************************

    COL             MIMQQYQDWHMEVEKVFACGGIPKKNAVMMDIYANVLNKKLIVMDSEYAPAIGAAILGAV
    N315            MIMQQYQDWHMEVEKVFACGGIPKKNAVMMDIYANVLNKKLIVMDSEYAPAIGAAILGAV
    NCTC8325        MIMQQYQDWHMEVEKVFACGGIPKKNAVMMDIYANVLNKKLIVMDSEYAPAIGAAILGAV
    Newman          MIMQQYQDWHMEVEKVFACGGIPKKNAVMMDIYANVLNKKLIVMDSEYAPAIGAAILGAV
    USA300_FPR3757  MIMQQYQDWHMEVEKVFACGGIPKKNAVMMDIYANVLNKKLIVMDSEYAPAIGAAILGAV
                    ************************************************************

    COL             SGGAHNSINDAVDAMKEPILYEINPEAEKVQRYETLFKAYKALHDIHGYKKANIMKDIQS
    N315            SGGAHNSINDAVDAMKEPILYEINPEAEKVQRYETLFKAYKALHDIHGYKKANIMKDIQS
    NCTC8325        SGGAHNSINDAVDAMKEPILYEINPEAEKVQRYETLFKAYKALHDIHGYKKANIMKDIQS
    Newman          SGGAHNSINDAVDAMKEPILYEINPEAEKVQRYETLFKAYKALHDIHGYKKANIMKDIQS
    USA300_FPR3757  SGGAHNSINDAVDAMKEPILYEINPEAEKVQRYETLFKAYKALHDIHGYKKANIMKDIQS
                    ************************************************************

    COL             LRVEG
    N315            LRVEG
    NCTC8325        LRVEG
    Newman          LRVEG
    USA300_FPR3757  LRVEG
                    *****