From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002329000
  • symbol?: dck
  • description?: deoxynucleoside kinase

      descriptions from strain specific annotations:

    • deoxynucleoside kinase
    • deoxynucleoside kinase family protein
    • Deoxyadenosine kinase / Deoxyguanosine kinase
    • deoxyadenosine/deoxycytidine kinase
    • Deoxycytidine kinase
    • deoxypurine kinase
    • deoxypurine kinase subunit
    • putative deoxyadenosine kinase protein
  • strand?: -
  • coordinates?: 2849674..2850336
  • synteny block?: BlockID0016280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0533
    08BA02176:
    C248_0631
    11819-97:
    MS7_0546 (dck)
    71193:
    ST398NM01_0631
    ECT-R 2:
    ECTR2_510
    ED133:
    SAOV_0591c
    ED98:
    SAAV_0519
    HO 5096 0412:
    SAEMRSA15_04830
    JH1:
    SaurJH1_0593
    JH9:
    SaurJH9_0579
    JKD6008:
    SAA6008_00563
    JKD6159:
    SAA6159_00510
    LGA251:
    SARLGA251_04920
    M013:
    M013TW_0543
    MRSA252:
    SAR0561
    MSHR1132:
    SAMSHR1132_05000
    MSSA476:
    SAS0514
    Mu3:
    SAHV_0554
    Mu50:
    SAV0556
    MW2:
    MW0511
    RF122:
    SAB0507c
    ST398:
    SAPIG0631
    T0131:
    SAT0131_00610
    TCH60:
    HMPREF0772_12633
    TW20:
    SATW20_06260
    USA300_TCH1516:
    USA300HOU_0550
    VC40:
    SAVC_02375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
    N315            MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
    NCTC8325        MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
    Newman          MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
    USA300_FPR3757  MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
                    ************************************************************

    COL             HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
    N315            HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
    NCTC8325        HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
    Newman          HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
    USA300_FPR3757  HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
                    ************************************************************

    COL             AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
    N315            AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
    NCTC8325        AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
    Newman          AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
    USA300_FPR3757  AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
                    ************************************************************

    COL             CPVVRININEYDIHKDPESLNPMINKIARIIQTYRQVDTR
    N315            CPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR
    NCTC8325        CPVVRININEYDIHKDPESLNPMINKIARIIQTYRQVDTR
    Newman          CPVVRININEYDIHKDPESLNPMINKIARIIQTYRQVDTR
    USA300_FPR3757  CPVVRININEYDIHKDPESLNPMINKIARIIQTYRQVDTR
                    ************************:***************